SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50914122|ref|YP_060094.1| from Streptococcus pyogenes MGAS10394

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50914122|ref|YP_060094.1|
Domain Number 1 Region: 6-326
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.76e-102
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50914122|ref|YP_060094.1|
Sequence length 326
Comment pyruvate dehydrogenase E1 component alpha subunit [Streptococcus pyogenes MGAS10394]
Sequence
MEAEMVTVSKEQHLDMFLKMERIREFDSRINKLVRRGFVQGMTHFSVGEEAANVGAVAHL
SYDDIIFSNHRGHGQSIAKDMDLNKMMAELAGKATGVSKGRGGSMHLADFEKGNYGTNGI
VGGGYALAVGAALTQQYKGTNNIAVAFSGDGATNEGSFHESVNMAATWKLPVIFFIINNR
YGISMSINNATNTPHLYTRAEAYGIPGFYCEDGNDVMAVYETMGKAVEHVRGGNGPAIVE
VESYRWFGHSTADAGKYRTKEEVDEWKEKDPMIKYRTYLTSEGIATDDELDAIQAQVKKE
VDDAYEFAQNSPDPELSVAFEDVWVD
Download sequence
Identical sequences Q1J6Y0 Q1JH60 Q1JM16 Q48TW3 Q5XCF2 U2UT69
gi|94988496|ref|YP_596597.1| gi|525809580|ref|YP_008243059.1| gi|71903395|ref|YP_280198.1| 193567.SPs1192 286636.M6_Spy0776 319701.M28_Spy0730 370551.MGAS9429_Spy0865 370552.MGAS10270_Spy0869 370553.MGAS2096_Spy0824 370554.MGAS10750_Spy0903 gi|50914122|ref|YP_060094.1| gi|94994299|ref|YP_602397.1| gi|28896104|ref|NP_802454.1| gi|94992321|ref|YP_600420.1| gi|94990378|ref|YP_598478.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]