SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50914123|ref|YP_060095.1| from Streptococcus pyogenes MGAS10394

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50914123|ref|YP_060095.1|
Domain Number 1 Region: 5-208
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.11e-62
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000917
Further Details:      
 
Domain Number 2 Region: 194-328
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.06e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50914123|ref|YP_060095.1|
Sequence length 333
Comment pyruvate dehydrogenase E1 component beta subunit [Streptococcus pyogenes MGAS10394]
Sequence
MMSETKLMALREAVNLAMTEEMRKDENIFLMGEDVGVYGGDFGTSVGMIEEFGPKRVKDT
PISEAAISGAAIGAAITGLRPIVDVTFMDFLTIMMDAIVNNGAKNNYMFGGGLITPVTFR
VASGSGIGSAAQHSQSLEAWLTHIPGIKVVAPGNANDAKGLLKSAIRDNNIVLFMEPKAL
YGKKEEVNQDPDFYIPLGKGDIKREGTDLTIVSYGRMLERVLQAAEEVAADGINVEVVDP
RTLIPLDKELIIESVKKTGKLMLVNDAYKTGGFIGEIATMITESEAFDYLDHPIVRLASE
DVPVPYARVLEQAILPDVEKIKAAIVKMANKGN
Download sequence
Identical sequences A0A0H3BZX8 A0A2H1X5B9 J7M7I5 Q1J6X9 Q1JH59 Q1JM15 Q48TW2 Q5XCF1 U2W1Q0
gi|383479929|ref|YP_005388823.1| gi|28896103|ref|NP_802453.1| gi|209559341|ref|YP_002285813.1| gi|71910565|ref|YP_282115.1| gi|71903396|ref|YP_280199.1| gi|523415118|ref|YP_007587341.2| gi|383493844|ref|YP_005411520.1| gi|94992322|ref|YP_600421.1| gi|94988497|ref|YP_596598.1| gi|50914123|ref|YP_060095.1| gi|94990379|ref|YP_598479.1| gi|94994300|ref|YP_602398.1| 193567.SPs1191 286636.M6_Spy0777 293653.M5005_Spy_0752 319701.M28_Spy0731 370551.MGAS9429_Spy0866 370552.MGAS10270_Spy0870 370553.MGAS2096_Spy0825 370554.MGAS10750_Spy0904 471876.Spy49_0808 gi|525809581|ref|YP_008243060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]