SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383326613|ref|YP_005387467.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|383326613|ref|YP_005387467.1|
Domain Number - Region: 9-71
Classification Level Classification E-value
Superfamily Ava3019-like 0.00759
Family Ava3019-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383326613|ref|YP_005387467.1|
Sequence length 117
Comment hypothetical protein SYNPCCP_2535 [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MKRNYLLTAIATLGILASLAPNANAQFRNYNRYNNYNNPGDRIGTPGFSQPIFMPNRSDT
YPNSYYRGHNRNYRGKDELTIINGGSNCINCRVDGWERRDRDNNWHHQRYRQEYFYY
Download sequence
Identical sequences L8AQZ2 Q55405
gi|16331701|ref|NP_442429.1| WP_010873727.1.11876 WP_010873727.1.1889 WP_010873727.1.18904 WP_010873727.1.33690 WP_010873727.1.35395 WP_010873727.1.47586 WP_010873727.1.99424 gi|383492497|ref|YP_005410174.1| gi|16331701|ref|NP_442429.1| gi|383326613|ref|YP_005387467.1| 1148.slr0579 gi|383323444|ref|YP_005384298.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]