SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383325371|ref|YP_005386224.1| from Synechocystis sp. PCC 6803 substr. PCC-P

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383325371|ref|YP_005386224.1|
Domain Number 1 Region: 10-84
Classification Level Classification E-value
Superfamily NE0471 N-terminal domain-like 0.00000000000000981
Family NE0471 N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383325371|ref|YP_005386224.1|
Sequence length 98
Comment hypothetical protein SYNPCCP_1292 [Synechocystis sp. PCC 6803 substr. PCC-P]
Sequence
MNSQVKTPWLKAISVFPLDNFQLQIKLENGQELILDLQTIIETNDNYWRLKNPRYFRQAQ
IDPLGGIAWPEGEDLSPTGLERYAKIAFPSTINDGLMS
Download sequence
Identical sequences L8AJC6 P73815
gi|383325371|ref|YP_005386224.1| 1148.ssl3692 gi|16330461|ref|NP_441189.1| WP_010872498.1.11876 WP_010872498.1.1889 WP_010872498.1.18904 WP_010872498.1.33690 WP_010872498.1.35395 WP_010872498.1.47586 WP_010872498.1.99424 gi|383322202|ref|YP_005383055.1| gi|383491255|ref|YP_005408931.1| gi|16330461|ref|NP_441189.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]