SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82542738|ref|YP_406685.1| from Shigella boydii Sb227

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82542738|ref|YP_406685.1|
Domain Number 1 Region: 21-151
Classification Level Classification E-value
Superfamily PapD-like 3.93e-42
Family Pilus chaperone 0.00026
Further Details:      
 
Domain Number 2 Region: 155-243
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 4.58e-19
Family Periplasmic chaperone C-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|82542738|ref|YP_406685.1|
Sequence length 246
Comment chaperone protein EcpD [Shigella boydii Sb227]
Sequence
MFFNTKHTTALCFVTCMAFSSSSIADIVISGTRVIYKSDQKSVNVRLENKGNNPLLVQSW
LDTGDDNAEPGSITVPFTATPPVSRIDAKRGQTIKLMYTASTSLPKDRESVFWFNVLEVP
PKPDAEKVANQSLLQLAFRTRIKLFYRPDGLKGNPSEAPLALKWFWSGSEGKASLRVTNP
TPYYVSFSSGDLEASGKRYPIDVKMIAPFSDEVMKVTGLNGKASSAKVHFYAINDFGGTI
EGNASL
Download sequence
Identical sequences A0A2K0Q582 Q326A1
WP_000465931.1.100447 WP_000465931.1.13144 WP_000465931.1.13798 WP_000465931.1.14253 WP_000465931.1.15768 WP_000465931.1.16862 WP_000465931.1.17734 WP_000465931.1.19651 WP_000465931.1.20907 WP_000465931.1.21024 WP_000465931.1.2325 WP_000465931.1.26125 WP_000465931.1.27426 WP_000465931.1.35039 WP_000465931.1.44452 WP_000465931.1.52704 WP_000465931.1.55185 WP_000465931.1.55870 WP_000465931.1.57349 WP_000465931.1.61806 WP_000465931.1.86717 WP_000465931.1.93150 WP_000465931.1.97502 300268.SBO_0126 gi|82542738|ref|YP_406685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]