SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82542826|ref|YP_406773.1| from Shigella boydii Sb227

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82542826|ref|YP_406773.1|
Domain Number 1 Region: 20-114
Classification Level Classification E-value
Superfamily PapD-like 0.0000419
Family Pilus chaperone 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82542826|ref|YP_406773.1|
Sequence length 222
Comment hypothetical protein SBO_0227 [Shigella boydii Sb227]
Sequence
MKKHLLPLALLFSGISPAQALDVGDISSFMNSDSSTLSKTIKNSTDSGRLINIRLERLSS
PLDDGQVISMDKPDELLLTPASLLLPAQASEVIRFFYKGPADEKERYYRIVWFDQALSDA
QRDNANRSAVATASARIGTILVVAPRQANYHFQYANGSLTNTGNATLRILAYGPCLKAAN
GKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPVK
Download sequence
Identical sequences A0A023YSN1 A0A025BWC1 A0A026V0V1 A0A028ALJ6 A0A028E7V3 A0A069XIG5 A0A070SN16 A0A070UJ53 A0A0A8UI03 A0A0E0Y6Q8 A0A0E1LY51 A0A0E2TN02 A0A0M7MMM9 A0A125X7B6 A0A1H0MLW2 A0A1X3JL42 A0A1X3L7H5 A0A1X3LMS4 A0A222QFM7 A0A236MTT8 A0A2A2XKR1 A7ZI26 B1XE34 B6I080 B7L423 D6I693 D7XGM0 D8ECW8 E0J3J9 E1JAW5 E6BQ15 E7TDC0 F4SIH8 F4VA57 G0FB24 H4UEW9 I0VR14 I2S4M0 I2XG69 I6D5V1 I6DG65 J7QCI7 J7RCP2 K4VKR2 M9GDP9 P77188 Q325R3 S1IJ47 U9Y3V5 W1EW72
gi|407467742|ref|YP_006785816.1| gi|218693754|ref|YP_002401421.1| gi|410484081|ref|YP_006771627.1| gi|407483523|ref|YP_006780672.1| gi|388476404|ref|YP_488588.1| gi|157159226|ref|YP_001461455.1| gi|544389149|ref|YP_008563513.1| gi|378714299|ref|YP_005279192.1| gi|386708095|ref|YP_006171816.1| gi|378714299|ref|YP_005279192.1| gi|170079916|ref|YP_001729236.1| gi|443616323|ref|YP_007380179.1| gi|387620055|ref|YP_006127682.1| gi|82542826|ref|YP_406773.1| gi|209917501|ref|YP_002291585.1| 300268.SBO_0227 316385.ECDH10B_0280 316407.yagY 331111.EcE24377A_0302 409438.ECSE_0310 511145.b0292 573235.ECO26_0327 585034.ECIAI1_0293 585055.EC55989_0296 gi|386708095|ref|YP_006171816.1| gi|387620055|ref|YP_006127682.1| gi|218552858|ref|YP_002385771.1| gi|16128277|ref|NP_414826.1| gi|260853522|ref|YP_003227413.1| NP_414826.1.90541 WP_000716398.1.1000 WP_000716398.1.100044 WP_000716398.1.100066 WP_000716398.1.100085 WP_000716398.1.100111 WP_000716398.1.100159 WP_000716398.1.100185 WP_000716398.1.100251 WP_000716398.1.100425 WP_000716398.1.100441 WP_000716398.1.100444 WP_000716398.1.100487 WP_000716398.1.100499 WP_000716398.1.10051 WP_000716398.1.100543 WP_000716398.1.100573 WP_000716398.1.100667 WP_000716398.1.10068 WP_000716398.1.100689 WP_000716398.1.100718 WP_000716398.1.100752 WP_000716398.1.100753 WP_000716398.1.100758 WP_000716398.1.100796 WP_000716398.1.10080 WP_000716398.1.100803 WP_000716398.1.100824 WP_000716398.1.100868 WP_000716398.1.100928 WP_000716398.1.10094 WP_000716398.1.101033 WP_000716398.1.101096 WP_000716398.1.101102 WP_000716398.1.101186 WP_000716398.1.101255 WP_000716398.1.10126 WP_000716398.1.101359 WP_000716398.1.101418 WP_000716398.1.101423 WP_000716398.1.101436 WP_000716398.1.101468 WP_000716398.1.101518 WP_000716398.1.10154 WP_000716398.1.101583 WP_000716398.1.101651 WP_000716398.1.101654 WP_000716398.1.101668 WP_000716398.1.101686 WP_000716398.1.10173 WP_000716398.1.101747 WP_000716398.1.10184 WP_000716398.1.101840 WP_000716398.1.101845 WP_000716398.1.10188 WP_000716398.1.101900 WP_000716398.1.101908 WP_000716398.1.101913 WP_000716398.1.101969 WP_000716398.1.101987 WP_000716398.1.10233 WP_000716398.1.10235 WP_000716398.1.10252 WP_000716398.1.1040 WP_000716398.1.10400 WP_000716398.1.10417 WP_000716398.1.10461 WP_000716398.1.10491 WP_000716398.1.10496 WP_000716398.1.10524 WP_000716398.1.10538 WP_000716398.1.10607 WP_000716398.1.10651 WP_000716398.1.10673 WP_000716398.1.1071 WP_000716398.1.10729 WP_000716398.1.10763 WP_000716398.1.10824 WP_000716398.1.10833 WP_000716398.1.10922 WP_000716398.1.10988 WP_000716398.1.10989 WP_000716398.1.10994 WP_000716398.1.11006 WP_000716398.1.11032 WP_000716398.1.11047 WP_000716398.1.11052 WP_000716398.1.11071 WP_000716398.1.11118 WP_000716398.1.11121 WP_000716398.1.1113 WP_000716398.1.11133 WP_000716398.1.112 WP_000716398.1.11296 WP_000716398.1.11408 WP_000716398.1.11418 WP_000716398.1.11524 WP_000716398.1.11542 WP_000716398.1.11578 WP_000716398.1.11645 WP_000716398.1.11759 WP_000716398.1.11801 WP_000716398.1.11803 WP_000716398.1.11844 WP_000716398.1.1186 WP_000716398.1.11949 WP_000716398.1.11955 WP_000716398.1.1196 WP_000716398.1.11982 WP_000716398.1.11985 WP_000716398.1.12030 WP_000716398.1.12051 WP_000716398.1.1212 WP_000716398.1.12319 WP_000716398.1.12320 WP_000716398.1.12342 WP_000716398.1.12344 WP_000716398.1.12415 WP_000716398.1.1242 WP_000716398.1.12458 WP_000716398.1.12478 WP_000716398.1.12542 WP_000716398.1.12558 WP_000716398.1.12566 WP_000716398.1.12582 WP_000716398.1.12623 WP_000716398.1.12645 WP_000716398.1.12646 WP_000716398.1.12693 WP_000716398.1.12717 WP_000716398.1.1275 WP_000716398.1.12756 WP_000716398.1.12762 WP_000716398.1.12766 WP_000716398.1.12775 WP_000716398.1.12781 WP_000716398.1.12876 WP_000716398.1.12911 WP_000716398.1.12914 WP_000716398.1.12979 WP_000716398.1.12987 WP_000716398.1.13015 WP_000716398.1.13031 WP_000716398.1.13074 WP_000716398.1.1312 WP_000716398.1.13136 WP_000716398.1.13144 WP_000716398.1.13176 WP_000716398.1.13222 WP_000716398.1.13239 WP_000716398.1.13252 WP_000716398.1.13258 WP_000716398.1.13278 WP_000716398.1.13281 WP_000716398.1.13290 WP_000716398.1.13301 WP_000716398.1.13333 WP_000716398.1.13492 WP_000716398.1.13495 WP_000716398.1.13525 WP_000716398.1.13585 WP_000716398.1.13601 WP_000716398.1.13618 WP_000716398.1.13624 WP_000716398.1.13664 WP_000716398.1.13791 WP_000716398.1.13798 WP_000716398.1.13924 WP_000716398.1.13944 WP_000716398.1.13949 WP_000716398.1.13974 WP_000716398.1.14030 WP_000716398.1.14058 WP_000716398.1.14062 WP_000716398.1.14070 WP_000716398.1.14199 WP_000716398.1.14253 WP_000716398.1.1438 WP_000716398.1.1439 WP_000716398.1.14432 WP_000716398.1.14493 WP_000716398.1.14508 WP_000716398.1.14529 WP_000716398.1.14600 WP_000716398.1.14601 WP_000716398.1.1461 WP_000716398.1.14693 WP_000716398.1.14811 WP_000716398.1.14833 WP_000716398.1.14871 WP_000716398.1.14879 WP_000716398.1.14977 WP_000716398.1.15041 WP_000716398.1.15117 WP_000716398.1.15121 WP_000716398.1.15138 WP_000716398.1.15177 WP_000716398.1.15193 WP_000716398.1.15221 WP_000716398.1.1524 WP_000716398.1.15259 WP_000716398.1.15277 WP_000716398.1.15282 WP_000716398.1.153 WP_000716398.1.15332 WP_000716398.1.15377 WP_000716398.1.15416 WP_000716398.1.1543 WP_000716398.1.15444 WP_000716398.1.15453 WP_000716398.1.15464 WP_000716398.1.15469 WP_000716398.1.15496 WP_000716398.1.15528 WP_000716398.1.15538 WP_000716398.1.15576 WP_000716398.1.15583 WP_000716398.1.15600 WP_000716398.1.15620 WP_000716398.1.15645 WP_000716398.1.15707 WP_000716398.1.15740 WP_000716398.1.15747 WP_000716398.1.15752 WP_000716398.1.15767 WP_000716398.1.15768 WP_000716398.1.1588 WP_000716398.1.15916 WP_000716398.1.16014 WP_000716398.1.16086 WP_000716398.1.1609 WP_000716398.1.16102 WP_000716398.1.16111 WP_000716398.1.16154 WP_000716398.1.16171 WP_000716398.1.16179 WP_000716398.1.16183 WP_000716398.1.16194 WP_000716398.1.16270 WP_000716398.1.16294 WP_000716398.1.163 WP_000716398.1.1634 WP_000716398.1.16387 WP_000716398.1.1640 WP_000716398.1.16517 WP_000716398.1.16532 WP_000716398.1.16539 WP_000716398.1.1655 WP_000716398.1.16577 WP_000716398.1.16592 WP_000716398.1.16648 WP_000716398.1.16682 WP_000716398.1.16715 WP_000716398.1.1673 WP_000716398.1.16745 WP_000716398.1.16752 WP_000716398.1.16862 WP_000716398.1.16992 WP_000716398.1.17018 WP_000716398.1.17084 WP_000716398.1.17087 WP_000716398.1.1710 WP_000716398.1.17102 WP_000716398.1.17109 WP_000716398.1.17111 WP_000716398.1.17114 WP_000716398.1.17150 WP_000716398.1.17153 WP_000716398.1.17170 WP_000716398.1.17172 WP_000716398.1.17182 WP_000716398.1.17241 WP_000716398.1.17290 WP_000716398.1.17297 WP_000716398.1.17410 WP_000716398.1.17432 WP_000716398.1.17464 WP_000716398.1.17534 WP_000716398.1.1754 WP_000716398.1.1755 WP_000716398.1.17550 WP_000716398.1.17577 WP_000716398.1.17595 WP_000716398.1.17637 WP_000716398.1.1766 WP_000716398.1.17734 WP_000716398.1.17766 WP_000716398.1.17802 WP_000716398.1.17829 WP_000716398.1.17831 WP_000716398.1.17920 WP_000716398.1.17961 WP_000716398.1.17963 WP_000716398.1.17984 WP_000716398.1.18000 WP_000716398.1.18006 WP_000716398.1.18064 WP_000716398.1.18094 WP_000716398.1.18164 WP_000716398.1.18175 WP_000716398.1.18225 WP_000716398.1.18275 WP_000716398.1.18329 WP_000716398.1.18381 WP_000716398.1.18402 WP_000716398.1.18410 WP_000716398.1.18438 WP_000716398.1.1844 WP_000716398.1.18482 WP_000716398.1.18530 WP_000716398.1.18550 WP_000716398.1.18649 WP_000716398.1.18666 WP_000716398.1.18726 WP_000716398.1.18858 WP_000716398.1.18861 WP_000716398.1.18874 WP_000716398.1.18876 WP_000716398.1.18899 WP_000716398.1.18936 WP_000716398.1.1906 WP_000716398.1.1909 WP_000716398.1.19100 WP_000716398.1.19114 WP_000716398.1.19147 WP_000716398.1.19150 WP_000716398.1.19205 WP_000716398.1.1925 WP_000716398.1.19277 WP_000716398.1.193 WP_000716398.1.19313 WP_000716398.1.19347 WP_000716398.1.19424 WP_000716398.1.19441 WP_000716398.1.19478 WP_000716398.1.19557 WP_000716398.1.19583 WP_000716398.1.1963 WP_000716398.1.19651 WP_000716398.1.19655 WP_000716398.1.19691 WP_000716398.1.19778 WP_000716398.1.1982 WP_000716398.1.19878 WP_000716398.1.19940 WP_000716398.1.20114 WP_000716398.1.20129 WP_000716398.1.20157 WP_000716398.1.20159 WP_000716398.1.20164 WP_000716398.1.20166 WP_000716398.1.20183 WP_000716398.1.20215 WP_000716398.1.20251 WP_000716398.1.20308 WP_000716398.1.20318 WP_000716398.1.20325 WP_000716398.1.20334 WP_000716398.1.20445 WP_000716398.1.20506 WP_000716398.1.20519 WP_000716398.1.20536 WP_000716398.1.20596 WP_000716398.1.20609 WP_000716398.1.2063 WP_000716398.1.20630 WP_000716398.1.20638 WP_000716398.1.20691 WP_000716398.1.20724 WP_000716398.1.20730 WP_000716398.1.20737 WP_000716398.1.20765 WP_000716398.1.20785 WP_000716398.1.20824 WP_000716398.1.20943 WP_000716398.1.20958 WP_000716398.1.20982 WP_000716398.1.2100 WP_000716398.1.21020 WP_000716398.1.21024 WP_000716398.1.21033 WP_000716398.1.21041 WP_000716398.1.21104 WP_000716398.1.21122 WP_000716398.1.21320 WP_000716398.1.21441 WP_000716398.1.21470 WP_000716398.1.2156 WP_000716398.1.21573 WP_000716398.1.21628 WP_000716398.1.2164 WP_000716398.1.21661 WP_000716398.1.21667 WP_000716398.1.21696 WP_000716398.1.21732 WP_000716398.1.21733 WP_000716398.1.21758 WP_000716398.1.21771 WP_000716398.1.21823 WP_000716398.1.21915 WP_000716398.1.21945 WP_000716398.1.22060 WP_000716398.1.22138 WP_000716398.1.22195 WP_000716398.1.22204 WP_000716398.1.22291 WP_000716398.1.22314 WP_000716398.1.22325 WP_000716398.1.22350 WP_000716398.1.22363 WP_000716398.1.22450 WP_000716398.1.22544 WP_000716398.1.22572 WP_000716398.1.22631 WP_000716398.1.22649 WP_000716398.1.22662 WP_000716398.1.22669 WP_000716398.1.22690 WP_000716398.1.22756 WP_000716398.1.22783 WP_000716398.1.22830 WP_000716398.1.22868 WP_000716398.1.22875 WP_000716398.1.22878 WP_000716398.1.22885 WP_000716398.1.23005 WP_000716398.1.23026 WP_000716398.1.23035 WP_000716398.1.23044 WP_000716398.1.23090 WP_000716398.1.23092 WP_000716398.1.23105 WP_000716398.1.23135 WP_000716398.1.2325 WP_000716398.1.23285 WP_000716398.1.23290 WP_000716398.1.23376 WP_000716398.1.23383 WP_000716398.1.23388 WP_000716398.1.23393 WP_000716398.1.23487 WP_000716398.1.23511 WP_000716398.1.23593 WP_000716398.1.23693 WP_000716398.1.23741 WP_000716398.1.23765 WP_000716398.1.23812 WP_000716398.1.23855 WP_000716398.1.23915 WP_000716398.1.23945 WP_000716398.1.23970 WP_000716398.1.24045 WP_000716398.1.24068 WP_000716398.1.24122 WP_000716398.1.24136 WP_000716398.1.24233 WP_000716398.1.2428 WP_000716398.1.2430 WP_000716398.1.24362 WP_000716398.1.24374 WP_000716398.1.24460 WP_000716398.1.24485 WP_000716398.1.24499 WP_000716398.1.24575 WP_000716398.1.24583 WP_000716398.1.24641 WP_000716398.1.24646 WP_000716398.1.24693 WP_000716398.1.24695 WP_000716398.1.24849 WP_000716398.1.24899 WP_000716398.1.24929 WP_000716398.1.24946 WP_000716398.1.24960 WP_000716398.1.24968 WP_000716398.1.24984 WP_000716398.1.25019 WP_000716398.1.25039 WP_000716398.1.2504 WP_000716398.1.25050 WP_000716398.1.25085 WP_000716398.1.25086 WP_000716398.1.25141 WP_000716398.1.25203 WP_000716398.1.25324 WP_000716398.1.2543 WP_000716398.1.2558 WP_000716398.1.25592 WP_000716398.1.25613 WP_000716398.1.25631 WP_000716398.1.25713 WP_000716398.1.25726 WP_000716398.1.25755 WP_000716398.1.25832 WP_000716398.1.2588 WP_000716398.1.25886 WP_000716398.1.25996 WP_000716398.1.26048 WP_000716398.1.26055 WP_000716398.1.26100 WP_000716398.1.26125 WP_000716398.1.26150 WP_000716398.1.26161 WP_000716398.1.26186 WP_000716398.1.26191 WP_000716398.1.26264 WP_000716398.1.26270 WP_000716398.1.26325 WP_000716398.1.2637 WP_000716398.1.26379 WP_000716398.1.26391 WP_000716398.1.26401 WP_000716398.1.26403 WP_000716398.1.2642 WP_000716398.1.26480 WP_000716398.1.26517 WP_000716398.1.26569 WP_000716398.1.26613 WP_000716398.1.26644 WP_000716398.1.26658 WP_000716398.1.26716 WP_000716398.1.26720 WP_000716398.1.26736 WP_000716398.1.26941 WP_000716398.1.26943 WP_000716398.1.27060 WP_000716398.1.27134 WP_000716398.1.27141 WP_000716398.1.27148 WP_000716398.1.27175 WP_000716398.1.27214 WP_000716398.1.27260 WP_000716398.1.27280 WP_000716398.1.27283 WP_000716398.1.27287 WP_000716398.1.27292 WP_000716398.1.2731 WP_000716398.1.27310 WP_000716398.1.27367 WP_000716398.1.27426 WP_000716398.1.27451 WP_000716398.1.27560 WP_000716398.1.27580 WP_000716398.1.27698 WP_000716398.1.27741 WP_000716398.1.27749 WP_000716398.1.27758 WP_000716398.1.27774 WP_000716398.1.27856 WP_000716398.1.27876 WP_000716398.1.27879 WP_000716398.1.27897 WP_000716398.1.27923 WP_000716398.1.27971 WP_000716398.1.28046 WP_000716398.1.28109 WP_000716398.1.2811 WP_000716398.1.28110 WP_000716398.1.28128 WP_000716398.1.2823 WP_000716398.1.28250 WP_000716398.1.2826 WP_000716398.1.28268 WP_000716398.1.28271 WP_000716398.1.28318 WP_000716398.1.28371 WP_000716398.1.28401 WP_000716398.1.28496 WP_000716398.1.28523 WP_000716398.1.28540 WP_000716398.1.28554 WP_000716398.1.28662 WP_000716398.1.28683 WP_000716398.1.28697 WP_000716398.1.28809 WP_000716398.1.2881 WP_000716398.1.28919 WP_000716398.1.28950 WP_000716398.1.28953 WP_000716398.1.28982 WP_000716398.1.290 WP_000716398.1.29001 WP_000716398.1.29026 WP_000716398.1.29061 WP_000716398.1.29125 WP_000716398.1.29128 WP_000716398.1.29150 WP_000716398.1.29176 WP_000716398.1.29194 WP_000716398.1.29202 WP_000716398.1.29221 WP_000716398.1.2945 WP_000716398.1.29503 WP_000716398.1.29504 WP_000716398.1.2952 WP_000716398.1.29683 WP_000716398.1.29715 WP_000716398.1.29746 WP_000716398.1.29752 WP_000716398.1.29798 WP_000716398.1.29812 WP_000716398.1.29874 WP_000716398.1.29876 WP_000716398.1.29992 WP_000716398.1.30035 WP_000716398.1.30123 WP_000716398.1.30231 WP_000716398.1.30247 WP_000716398.1.30253 WP_000716398.1.30472 WP_000716398.1.30479 WP_000716398.1.30497 WP_000716398.1.30546 WP_000716398.1.30630 WP_000716398.1.30733 WP_000716398.1.30742 WP_000716398.1.30749 WP_000716398.1.30783 WP_000716398.1.30843 WP_000716398.1.31000 WP_000716398.1.31009 WP_000716398.1.31089 WP_000716398.1.31211 WP_000716398.1.31295 WP_000716398.1.31379 WP_000716398.1.31407 WP_000716398.1.31419 WP_000716398.1.31429 WP_000716398.1.31431 WP_000716398.1.31518 WP_000716398.1.31614 WP_000716398.1.31709 WP_000716398.1.31740 WP_000716398.1.31833 WP_000716398.1.31835 WP_000716398.1.31860 WP_000716398.1.31898 WP_000716398.1.31978 WP_000716398.1.32091 WP_000716398.1.3212 WP_000716398.1.32121 WP_000716398.1.32127 WP_000716398.1.32142 WP_000716398.1.32143 WP_000716398.1.32232 WP_000716398.1.32234 WP_000716398.1.3233 WP_000716398.1.32394 WP_000716398.1.3247 WP_000716398.1.32475 WP_000716398.1.32479 WP_000716398.1.3248 WP_000716398.1.32494 WP_000716398.1.32509 WP_000716398.1.32561 WP_000716398.1.32591 WP_000716398.1.32661 WP_000716398.1.32680 WP_000716398.1.32709 WP_000716398.1.32724 WP_000716398.1.32811 WP_000716398.1.32831 WP_000716398.1.32835 WP_000716398.1.32875 WP_000716398.1.32903 WP_000716398.1.32946 WP_000716398.1.32959 WP_000716398.1.32972 WP_000716398.1.32984 WP_000716398.1.32992 WP_000716398.1.32995 WP_000716398.1.33004 WP_000716398.1.33014 WP_000716398.1.33018 WP_000716398.1.33022 WP_000716398.1.33244 WP_000716398.1.33325 WP_000716398.1.33341 WP_000716398.1.33385 WP_000716398.1.33408 WP_000716398.1.33422 WP_000716398.1.33502 WP_000716398.1.33512 WP_000716398.1.33565 WP_000716398.1.33595 WP_000716398.1.33631 WP_000716398.1.33648 WP_000716398.1.33736 WP_000716398.1.33745 WP_000716398.1.33746 WP_000716398.1.33751 WP_000716398.1.33853 WP_000716398.1.33854 WP_000716398.1.33879 WP_000716398.1.33914 WP_000716398.1.33952 WP_000716398.1.3398 WP_000716398.1.3411 WP_000716398.1.34124 WP_000716398.1.342 WP_000716398.1.34270 WP_000716398.1.34273 WP_000716398.1.34277 WP_000716398.1.34332 WP_000716398.1.34341 WP_000716398.1.34363 WP_000716398.1.34397 WP_000716398.1.3444 WP_000716398.1.34444 WP_000716398.1.34464 WP_000716398.1.34525 WP_000716398.1.34532 WP_000716398.1.34538 WP_000716398.1.34605 WP_000716398.1.34682 WP_000716398.1.34727 WP_000716398.1.34781 WP_000716398.1.34782 WP_000716398.1.34794 WP_000716398.1.34855 WP_000716398.1.34948 WP_000716398.1.34993 WP_000716398.1.35006 WP_000716398.1.35039 WP_000716398.1.35114 WP_000716398.1.35195 WP_000716398.1.35202 WP_000716398.1.35204 WP_000716398.1.35211 WP_000716398.1.35360 WP_000716398.1.35365 WP_000716398.1.35376 WP_000716398.1.3539 WP_000716398.1.35465 WP_000716398.1.35466 WP_000716398.1.35552 WP_000716398.1.35581 WP_000716398.1.3560 WP_000716398.1.35651 WP_000716398.1.35653 WP_000716398.1.35724 WP_000716398.1.35740 WP_000716398.1.35904 WP_000716398.1.35922 WP_000716398.1.35942 WP_000716398.1.35959 WP_000716398.1.36042 WP_000716398.1.36070 WP_000716398.1.36071 WP_000716398.1.36094 WP_000716398.1.36164 WP_000716398.1.36166 WP_000716398.1.36177 WP_000716398.1.36182 WP_000716398.1.3620 WP_000716398.1.36207 WP_000716398.1.36334 WP_000716398.1.36386 WP_000716398.1.36426 WP_000716398.1.36500 WP_000716398.1.36523 WP_000716398.1.36531 WP_000716398.1.36610 WP_000716398.1.36628 WP_000716398.1.3671 WP_000716398.1.36746 WP_000716398.1.36747 WP_000716398.1.36812 WP_000716398.1.36826 WP_000716398.1.36925 WP_000716398.1.36975 WP_000716398.1.37020 WP_000716398.1.37046 WP_000716398.1.37099 WP_000716398.1.3723 WP_000716398.1.37233 WP_000716398.1.37252 WP_000716398.1.37329 WP_000716398.1.37371 WP_000716398.1.37433 WP_000716398.1.37445 WP_000716398.1.37472 WP_000716398.1.37485 WP_000716398.1.37538 WP_000716398.1.37548 WP_000716398.1.37576 WP_000716398.1.37588 WP_000716398.1.37634 WP_000716398.1.377 WP_000716398.1.3772 WP_000716398.1.37750 WP_000716398.1.37758 WP_000716398.1.37762 WP_000716398.1.37773 WP_000716398.1.37852 WP_000716398.1.37880 WP_000716398.1.37887 WP_000716398.1.37897 WP_000716398.1.37917 WP_000716398.1.38081 WP_000716398.1.38105 WP_000716398.1.3811 WP_000716398.1.38120 WP_000716398.1.38182 WP_000716398.1.3822 WP_000716398.1.38257 WP_000716398.1.38314 WP_000716398.1.38357 WP_000716398.1.38412 WP_000716398.1.38544 WP_000716398.1.38584 WP_000716398.1.38636 WP_000716398.1.38694 WP_000716398.1.38751 WP_000716398.1.38777 WP_000716398.1.38811 WP_000716398.1.38896 WP_000716398.1.38920 WP_000716398.1.38935 WP_000716398.1.38950 WP_000716398.1.38956 WP_000716398.1.39005 WP_000716398.1.39103 WP_000716398.1.39164 WP_000716398.1.39249 WP_000716398.1.39302 WP_000716398.1.39342 WP_000716398.1.39356 WP_000716398.1.39365 WP_000716398.1.39430 WP_000716398.1.39481 WP_000716398.1.39509 WP_000716398.1.39531 WP_000716398.1.3954 WP_000716398.1.39606 WP_000716398.1.39610 WP_000716398.1.39636 WP_000716398.1.39690 WP_000716398.1.39822 WP_000716398.1.39870 WP_000716398.1.39938 WP_000716398.1.39961 WP_000716398.1.39966 WP_000716398.1.39970 WP_000716398.1.40013 WP_000716398.1.40016 WP_000716398.1.40088 WP_000716398.1.40192 WP_000716398.1.40206 WP_000716398.1.40212 WP_000716398.1.40218 WP_000716398.1.40238 WP_000716398.1.40249 WP_000716398.1.40317 WP_000716398.1.40319 WP_000716398.1.40382 WP_000716398.1.40389 WP_000716398.1.40403 WP_000716398.1.40445 WP_000716398.1.4049 WP_000716398.1.40499 WP_000716398.1.40502 WP_000716398.1.40509 WP_000716398.1.40524 WP_000716398.1.40548 WP_000716398.1.40563 WP_000716398.1.40596 WP_000716398.1.40599 WP_000716398.1.406 WP_000716398.1.40686 WP_000716398.1.40712 WP_000716398.1.40813 WP_000716398.1.40815 WP_000716398.1.4082 WP_000716398.1.40898 WP_000716398.1.40912 WP_000716398.1.40937 WP_000716398.1.41037 WP_000716398.1.41147 WP_000716398.1.41206 WP_000716398.1.4126 WP_000716398.1.41263 WP_000716398.1.41315 WP_000716398.1.41346 WP_000716398.1.41368 WP_000716398.1.41392 WP_000716398.1.41402 WP_000716398.1.41407 WP_000716398.1.41417 WP_000716398.1.4142 WP_000716398.1.41436 WP_000716398.1.41466 WP_000716398.1.41479 WP_000716398.1.41488 WP_000716398.1.41530 WP_000716398.1.41545 WP_000716398.1.41556 WP_000716398.1.41566 WP_000716398.1.41621 WP_000716398.1.41651 WP_000716398.1.41740 WP_000716398.1.41752 WP_000716398.1.41780 WP_000716398.1.41782 WP_000716398.1.41784 WP_000716398.1.41812 WP_000716398.1.41900 WP_000716398.1.41988 WP_000716398.1.42022 WP_000716398.1.42027 WP_000716398.1.42033 WP_000716398.1.42038 WP_000716398.1.42073 WP_000716398.1.42113 WP_000716398.1.42138 WP_000716398.1.4214 WP_000716398.1.42179 WP_000716398.1.42203 WP_000716398.1.42209 WP_000716398.1.42214 WP_000716398.1.42226 WP_000716398.1.42252 WP_000716398.1.42318 WP_000716398.1.42367 WP_000716398.1.42376 WP_000716398.1.42387 WP_000716398.1.42415 WP_000716398.1.4242 WP_000716398.1.42442 WP_000716398.1.42522 WP_000716398.1.42661 WP_000716398.1.42669 WP_000716398.1.42749 WP_000716398.1.42813 WP_000716398.1.4282 WP_000716398.1.42879 WP_000716398.1.42891 WP_000716398.1.4290 WP_000716398.1.42918 WP_000716398.1.42936 WP_000716398.1.42937 WP_000716398.1.42962 WP_000716398.1.4306 WP_000716398.1.43137 WP_000716398.1.43166 WP_000716398.1.43177 WP_000716398.1.43239 WP_000716398.1.43270 WP_000716398.1.43316 WP_000716398.1.43363 WP_000716398.1.43444 WP_000716398.1.43474 WP_000716398.1.43489 WP_000716398.1.43598 WP_000716398.1.43720 WP_000716398.1.43750 WP_000716398.1.43769 WP_000716398.1.43804 WP_000716398.1.43898 WP_000716398.1.43925 WP_000716398.1.44018 WP_000716398.1.44020 WP_000716398.1.44029 WP_000716398.1.44040 WP_000716398.1.44077 WP_000716398.1.44088 WP_000716398.1.44096 WP_000716398.1.44115 WP_000716398.1.44162 WP_000716398.1.44166 WP_000716398.1.44238 WP_000716398.1.44273 WP_000716398.1.44292 WP_000716398.1.44365 WP_000716398.1.44452 WP_000716398.1.44458 WP_000716398.1.4449 WP_000716398.1.44524 WP_000716398.1.44558 WP_000716398.1.44570 WP_000716398.1.44587 WP_000716398.1.44608 WP_000716398.1.44610 WP_000716398.1.44661 WP_000716398.1.4473 WP_000716398.1.44756 WP_000716398.1.44840 WP_000716398.1.44841 WP_000716398.1.44849 WP_000716398.1.44854 WP_000716398.1.44857 WP_000716398.1.44923 WP_000716398.1.44970 WP_000716398.1.44980 WP_000716398.1.45116 WP_000716398.1.4516 WP_000716398.1.45208 WP_000716398.1.45246 WP_000716398.1.45301 WP_000716398.1.45329 WP_000716398.1.45359 WP_000716398.1.45440 WP_000716398.1.45565 WP_000716398.1.45581 WP_000716398.1.45595 WP_000716398.1.45664 WP_000716398.1.4570 WP_000716398.1.45718 WP_000716398.1.4574 WP_000716398.1.45741 WP_000716398.1.45840 WP_000716398.1.45846 WP_000716398.1.45868 WP_000716398.1.45933 WP_000716398.1.45960 WP_000716398.1.45968 WP_000716398.1.46026 WP_000716398.1.46048 WP_000716398.1.46049 WP_000716398.1.46070 WP_000716398.1.46105 WP_000716398.1.46115 WP_000716398.1.4613 WP_000716398.1.46186 WP_000716398.1.46197 WP_000716398.1.46213 WP_000716398.1.46239 WP_000716398.1.46257 WP_000716398.1.46325 WP_000716398.1.4646 WP_000716398.1.4647 WP_000716398.1.46477 WP_000716398.1.46552 WP_000716398.1.4657 WP_000716398.1.46582 WP_000716398.1.46602 WP_000716398.1.46614 WP_000716398.1.46616 WP_000716398.1.46802 WP_000716398.1.46820 WP_000716398.1.46821 WP_000716398.1.46876 WP_000716398.1.46882 WP_000716398.1.46898 WP_000716398.1.46909 WP_000716398.1.4691 WP_000716398.1.46912 WP_000716398.1.46990 WP_000716398.1.46999 WP_000716398.1.47028 WP_000716398.1.47029 WP_000716398.1.47038 WP_000716398.1.47050 WP_000716398.1.47063 WP_000716398.1.47197 WP_000716398.1.4722 WP_000716398.1.47224 WP_000716398.1.47280 WP_000716398.1.47356 WP_000716398.1.47370 WP_000716398.1.47401 WP_000716398.1.47414 WP_000716398.1.47425 WP_000716398.1.47477 WP_000716398.1.47496 WP_000716398.1.47634 WP_000716398.1.47646 WP_000716398.1.47662 WP_000716398.1.47673 WP_000716398.1.4772 WP_000716398.1.47740 WP_000716398.1.47744 WP_000716398.1.47761 WP_000716398.1.47765 WP_000716398.1.47790 WP_000716398.1.47820 WP_000716398.1.47848 WP_000716398.1.4785 WP_000716398.1.4796 WP_000716398.1.47962 WP_000716398.1.48000 WP_000716398.1.48018 WP_000716398.1.48040 WP_000716398.1.48048 WP_000716398.1.48073 WP_000716398.1.48096 WP_000716398.1.48111 WP_000716398.1.48144 WP_000716398.1.48168 WP_000716398.1.48188 WP_000716398.1.48194 WP_000716398.1.48203 WP_000716398.1.48222 WP_000716398.1.48291 WP_000716398.1.48353 WP_000716398.1.48355 WP_000716398.1.48371 WP_000716398.1.48385 WP_000716398.1.48421 WP_000716398.1.48433 WP_000716398.1.48480 WP_000716398.1.48483 WP_000716398.1.48505 WP_000716398.1.4857 WP_000716398.1.48571 WP_000716398.1.486 WP_000716398.1.48678 WP_000716398.1.4871 WP_000716398.1.48771 WP_000716398.1.48860 WP_000716398.1.48901 WP_000716398.1.48910 WP_000716398.1.48926 WP_000716398.1.48928 WP_000716398.1.48953 WP_000716398.1.48974 WP_000716398.1.49009 WP_000716398.1.49124 WP_000716398.1.49190 WP_000716398.1.49236 WP_000716398.1.49243 WP_000716398.1.49275 WP_000716398.1.49336 WP_000716398.1.49363 WP_000716398.1.49459 WP_000716398.1.49482 WP_000716398.1.49531 WP_000716398.1.49537 WP_000716398.1.49599 WP_000716398.1.49645 WP_000716398.1.49661 WP_000716398.1.497 WP_000716398.1.49712 WP_000716398.1.49722 WP_000716398.1.49733 WP_000716398.1.49747 WP_000716398.1.49768 WP_000716398.1.49774 WP_000716398.1.49879 WP_000716398.1.49900 WP_000716398.1.49950 WP_000716398.1.49954 WP_000716398.1.49987 WP_000716398.1.50008 WP_000716398.1.50078 WP_000716398.1.50119 WP_000716398.1.5017 WP_000716398.1.50182 WP_000716398.1.50262 WP_000716398.1.50269 WP_000716398.1.50278 WP_000716398.1.50353 WP_000716398.1.50361 WP_000716398.1.50366 WP_000716398.1.50412 WP_000716398.1.50418 WP_000716398.1.50452 WP_000716398.1.5056 WP_000716398.1.50564 WP_000716398.1.50579 WP_000716398.1.50586 WP_000716398.1.50616 WP_000716398.1.50715 WP_000716398.1.50717 WP_000716398.1.50725 WP_000716398.1.50939 WP_000716398.1.5095 WP_000716398.1.50969 WP_000716398.1.50996 WP_000716398.1.51013 WP_000716398.1.51027 WP_000716398.1.51042 WP_000716398.1.51058 WP_000716398.1.51109 WP_000716398.1.51172 WP_000716398.1.51175 WP_000716398.1.51248 WP_000716398.1.51260 WP_000716398.1.5128 WP_000716398.1.51299 WP_000716398.1.51323 WP_000716398.1.51325 WP_000716398.1.51425 WP_000716398.1.51441 WP_000716398.1.5146 WP_000716398.1.51462 WP_000716398.1.51490 WP_000716398.1.51495 WP_000716398.1.51537 WP_000716398.1.51539 WP_000716398.1.51552 WP_000716398.1.51580 WP_000716398.1.51629 WP_000716398.1.51707 WP_000716398.1.51718 WP_000716398.1.5172 WP_000716398.1.51873 WP_000716398.1.51968 WP_000716398.1.51988 WP_000716398.1.51999 WP_000716398.1.52002 WP_000716398.1.52020 WP_000716398.1.52076 WP_000716398.1.52127 WP_000716398.1.52171 WP_000716398.1.52186 WP_000716398.1.52211 WP_000716398.1.52243 WP_000716398.1.52249 WP_000716398.1.5227 WP_000716398.1.52272 WP_000716398.1.52305 WP_000716398.1.52378 WP_000716398.1.52399 WP_000716398.1.52492 WP_000716398.1.52524 WP_000716398.1.52544 WP_000716398.1.52558 WP_000716398.1.52612 WP_000716398.1.52691 WP_000716398.1.52704 WP_000716398.1.5272 WP_000716398.1.52774 WP_000716398.1.52777 WP_000716398.1.52780 WP_000716398.1.52801 WP_000716398.1.52844 WP_000716398.1.52852 WP_000716398.1.52853 WP_000716398.1.52881 WP_000716398.1.52895 WP_000716398.1.52945 WP_000716398.1.52995 WP_000716398.1.53012 WP_000716398.1.53020 WP_000716398.1.5310 WP_000716398.1.53110 WP_000716398.1.53155 WP_000716398.1.532 WP_000716398.1.53223 WP_000716398.1.53238 WP_000716398.1.53251 WP_000716398.1.53262 WP_000716398.1.53377 WP_000716398.1.53401 WP_000716398.1.5342 WP_000716398.1.53428 WP_000716398.1.53505 WP_000716398.1.53537 WP_000716398.1.53545 WP_000716398.1.53592 WP_000716398.1.53645 WP_000716398.1.53706 WP_000716398.1.53769 WP_000716398.1.53809 WP_000716398.1.53841 WP_000716398.1.53884 WP_000716398.1.53931 WP_000716398.1.53966 WP_000716398.1.53972 WP_000716398.1.53978 WP_000716398.1.53994 WP_000716398.1.54013 WP_000716398.1.54023 WP_000716398.1.54169 WP_000716398.1.54317 WP_000716398.1.54344 WP_000716398.1.54359 WP_000716398.1.54507 WP_000716398.1.54591 WP_000716398.1.5460 WP_000716398.1.54602 WP_000716398.1.54605 WP_000716398.1.5461 WP_000716398.1.54617 WP_000716398.1.54620 WP_000716398.1.54625 WP_000716398.1.54695 WP_000716398.1.54769 WP_000716398.1.5479 WP_000716398.1.54798 WP_000716398.1.54817 WP_000716398.1.54829 WP_000716398.1.54918 WP_000716398.1.54941 WP_000716398.1.54981 WP_000716398.1.54991 WP_000716398.1.55003 WP_000716398.1.55009 WP_000716398.1.55041 WP_000716398.1.55115 WP_000716398.1.55123 WP_000716398.1.55134 WP_000716398.1.55185 WP_000716398.1.55197 WP_000716398.1.55203 WP_000716398.1.55222 WP_000716398.1.55291 WP_000716398.1.55338 WP_000716398.1.55342 WP_000716398.1.55357 WP_000716398.1.55381 WP_000716398.1.55417 WP_000716398.1.55424 WP_000716398.1.55466 WP_000716398.1.55489 WP_000716398.1.55529 WP_000716398.1.55551 WP_000716398.1.55552 WP_000716398.1.55560 WP_000716398.1.55574 WP_000716398.1.55597 WP_000716398.1.55608 WP_000716398.1.5561 WP_000716398.1.55629 WP_000716398.1.5570 WP_000716398.1.55757 WP_000716398.1.55787 WP_000716398.1.55791 WP_000716398.1.55825 WP_000716398.1.55868 WP_000716398.1.55870 WP_000716398.1.55988 WP_000716398.1.561 WP_000716398.1.5614 WP_000716398.1.56149 WP_000716398.1.5616 WP_000716398.1.56164 WP_000716398.1.56177 WP_000716398.1.56193 WP_000716398.1.56371 WP_000716398.1.56436 WP_000716398.1.56513 WP_000716398.1.56528 WP_000716398.1.56543 WP_000716398.1.56665 WP_000716398.1.56680 WP_000716398.1.56689 WP_000716398.1.56742 WP_000716398.1.56789 WP_000716398.1.56799 WP_000716398.1.56846 WP_000716398.1.56871 WP_000716398.1.56932 WP_000716398.1.56934 WP_000716398.1.56978 WP_000716398.1.57072 WP_000716398.1.57086 WP_000716398.1.57124 WP_000716398.1.57181 WP_000716398.1.57222 WP_000716398.1.57281 WP_000716398.1.57349 WP_000716398.1.57403 WP_000716398.1.57410 WP_000716398.1.57432 WP_000716398.1.57487 WP_000716398.1.57538 WP_000716398.1.5755 WP_000716398.1.57558 WP_000716398.1.57638 WP_000716398.1.57719 WP_000716398.1.57738 WP_000716398.1.57812 WP_000716398.1.57846 WP_000716398.1.57904 WP_000716398.1.58001 WP_000716398.1.58022 WP_000716398.1.58045 WP_000716398.1.58080 WP_000716398.1.58143 WP_000716398.1.58163 WP_000716398.1.58226 WP_000716398.1.58232 WP_000716398.1.58267 WP_000716398.1.58316 WP_000716398.1.58340 WP_000716398.1.58371 WP_000716398.1.5842 WP_000716398.1.58420 WP_000716398.1.58440 WP_000716398.1.58445 WP_000716398.1.58507 WP_000716398.1.58528 WP_000716398.1.58547 WP_000716398.1.58582 WP_000716398.1.58622 WP_000716398.1.58705 WP_000716398.1.58867 WP_000716398.1.58870 WP_000716398.1.58940 WP_000716398.1.58958 WP_000716398.1.58976 WP_000716398.1.59024 WP_000716398.1.59083 WP_000716398.1.59174 WP_000716398.1.59190 WP_000716398.1.59293 WP_000716398.1.59306 WP_000716398.1.59395 WP_000716398.1.59407 WP_000716398.1.59409 WP_000716398.1.59423 WP_000716398.1.59513 WP_000716398.1.59533 WP_000716398.1.59553 WP_000716398.1.59590 WP_000716398.1.59615 WP_000716398.1.59638 WP_000716398.1.5965 WP_000716398.1.59730 WP_000716398.1.59737 WP_000716398.1.59756 WP_000716398.1.59781 WP_000716398.1.59782 WP_000716398.1.59823 WP_000716398.1.59836 WP_000716398.1.59858 WP_000716398.1.59877 WP_000716398.1.59932 WP_000716398.1.59998 WP_000716398.1.6002 WP_000716398.1.60023 WP_000716398.1.60031 WP_000716398.1.60070 WP_000716398.1.60228 WP_000716398.1.60325 WP_000716398.1.60387 WP_000716398.1.60436 WP_000716398.1.60457 WP_000716398.1.60477 WP_000716398.1.60491 WP_000716398.1.60498 WP_000716398.1.60550 WP_000716398.1.60576 WP_000716398.1.6059 WP_000716398.1.6061 WP_000716398.1.6064 WP_000716398.1.6066 WP_000716398.1.60717 WP_000716398.1.60732 WP_000716398.1.60764 WP_000716398.1.60832 WP_000716398.1.60895 WP_000716398.1.60901 WP_000716398.1.60927 WP_000716398.1.61058 WP_000716398.1.6106 WP_000716398.1.61096 WP_000716398.1.61097 WP_000716398.1.6110 WP_000716398.1.61112 WP_000716398.1.61170 WP_000716398.1.61174 WP_000716398.1.61241 WP_000716398.1.61505 WP_000716398.1.61517 WP_000716398.1.61608 WP_000716398.1.61636 WP_000716398.1.61663 WP_000716398.1.61779 WP_000716398.1.61822 WP_000716398.1.61926 WP_000716398.1.61939 WP_000716398.1.61949 WP_000716398.1.61957 WP_000716398.1.62041 WP_000716398.1.6212 WP_000716398.1.62264 WP_000716398.1.62290 WP_000716398.1.62296 WP_000716398.1.62358 WP_000716398.1.62447 WP_000716398.1.62514 WP_000716398.1.62529 WP_000716398.1.62668 WP_000716398.1.62681 WP_000716398.1.62714 WP_000716398.1.62735 WP_000716398.1.62762 WP_000716398.1.62812 WP_000716398.1.62818 WP_000716398.1.62840 WP_000716398.1.62850 WP_000716398.1.62851 WP_000716398.1.62914 WP_000716398.1.62919 WP_000716398.1.6293 WP_000716398.1.62931 WP_000716398.1.62989 WP_000716398.1.6299 WP_000716398.1.63167 WP_000716398.1.63189 WP_000716398.1.63287 WP_000716398.1.6337 WP_000716398.1.63370 WP_000716398.1.63393 WP_000716398.1.63437 WP_000716398.1.63453 WP_000716398.1.63467 WP_000716398.1.63491 WP_000716398.1.63556 WP_000716398.1.63703 WP_000716398.1.63746 WP_000716398.1.63810 WP_000716398.1.63821 WP_000716398.1.63964 WP_000716398.1.64008 WP_000716398.1.64040 WP_000716398.1.64050 WP_000716398.1.64074 WP_000716398.1.64175 WP_000716398.1.64193 WP_000716398.1.64285 WP_000716398.1.64286 WP_000716398.1.64321 WP_000716398.1.64337 WP_000716398.1.64353 WP_000716398.1.64355 WP_000716398.1.64380 WP_000716398.1.6441 WP_000716398.1.64438 WP_000716398.1.64448 WP_000716398.1.64458 WP_000716398.1.64519 WP_000716398.1.64657 WP_000716398.1.64693 WP_000716398.1.64707 WP_000716398.1.64746 WP_000716398.1.64784 WP_000716398.1.64789 WP_000716398.1.64881 WP_000716398.1.64912 WP_000716398.1.64926 WP_000716398.1.64970 WP_000716398.1.65056 WP_000716398.1.65097 WP_000716398.1.651 WP_000716398.1.65151 WP_000716398.1.65179 WP_000716398.1.65206 WP_000716398.1.65256 WP_000716398.1.65271 WP_000716398.1.65306 WP_000716398.1.65353 WP_000716398.1.65364 WP_000716398.1.6537 WP_000716398.1.65370 WP_000716398.1.654 WP_000716398.1.65408 WP_000716398.1.65413 WP_000716398.1.65531 WP_000716398.1.65596 WP_000716398.1.65672 WP_000716398.1.65762 WP_000716398.1.65961 WP_000716398.1.65962 WP_000716398.1.66050 WP_000716398.1.6609 WP_000716398.1.66094 WP_000716398.1.66104 WP_000716398.1.66105 WP_000716398.1.66121 WP_000716398.1.66181 WP_000716398.1.66251 WP_000716398.1.66288 WP_000716398.1.6635 WP_000716398.1.66387 WP_000716398.1.66389 WP_000716398.1.66395 WP_000716398.1.66501 WP_000716398.1.6654 WP_000716398.1.66550 WP_000716398.1.66559 WP_000716398.1.66579 WP_000716398.1.66644 WP_000716398.1.6665 WP_000716398.1.66700 WP_000716398.1.66719 WP_000716398.1.66758 WP_000716398.1.6676 WP_000716398.1.66783 WP_000716398.1.66795 WP_000716398.1.66796 WP_000716398.1.66849 WP_000716398.1.66926 WP_000716398.1.66933 WP_000716398.1.66948 WP_000716398.1.67018 WP_000716398.1.67022 WP_000716398.1.67102 WP_000716398.1.67116 WP_000716398.1.67194 WP_000716398.1.67209 WP_000716398.1.6723 WP_000716398.1.6735 WP_000716398.1.67383 WP_000716398.1.67415 WP_000716398.1.67451 WP_000716398.1.67452 WP_000716398.1.67454 WP_000716398.1.67468 WP_000716398.1.67522 WP_000716398.1.67549 WP_000716398.1.67553 WP_000716398.1.67581 WP_000716398.1.67701 WP_000716398.1.67786 WP_000716398.1.67787 WP_000716398.1.678 WP_000716398.1.67810 WP_000716398.1.67841 WP_000716398.1.67975 WP_000716398.1.67999 WP_000716398.1.68008 WP_000716398.1.68012 WP_000716398.1.6802 WP_000716398.1.68025 WP_000716398.1.6803 WP_000716398.1.68079 WP_000716398.1.6814 WP_000716398.1.68170 WP_000716398.1.68215 WP_000716398.1.68271 WP_000716398.1.68283 WP_000716398.1.68300 WP_000716398.1.68336 WP_000716398.1.68341 WP_000716398.1.68347 WP_000716398.1.68396 WP_000716398.1.68442 WP_000716398.1.68534 WP_000716398.1.68566 WP_000716398.1.6860 WP_000716398.1.68697 WP_000716398.1.68711 WP_000716398.1.68751 WP_000716398.1.6877 WP_000716398.1.68797 WP_000716398.1.68801 WP_000716398.1.68989 WP_000716398.1.6916 WP_000716398.1.69247 WP_000716398.1.69261 WP_000716398.1.69303 WP_000716398.1.69305 WP_000716398.1.694 WP_000716398.1.69472 WP_000716398.1.69551 WP_000716398.1.69589 WP_000716398.1.69593 WP_000716398.1.69646 WP_000716398.1.69649 WP_000716398.1.69803 WP_000716398.1.69887 WP_000716398.1.6993 WP_000716398.1.69972 WP_000716398.1.70063 WP_000716398.1.70149 WP_000716398.1.70200 WP_000716398.1.70357 WP_000716398.1.70407 WP_000716398.1.70477 WP_000716398.1.70492 WP_000716398.1.70578 WP_000716398.1.70592 WP_000716398.1.70694 WP_000716398.1.70705 WP_000716398.1.70748 WP_000716398.1.70767 WP_000716398.1.70794 WP_000716398.1.70801 WP_000716398.1.70803 WP_000716398.1.70880 WP_000716398.1.7090 WP_000716398.1.70900 WP_000716398.1.70952 WP_000716398.1.70967 WP_000716398.1.71042 WP_000716398.1.71134 WP_000716398.1.71147 WP_000716398.1.71159 WP_000716398.1.71192 WP_000716398.1.71199 WP_000716398.1.71221 WP_000716398.1.71229 WP_000716398.1.71275 WP_000716398.1.71315 WP_000716398.1.71323 WP_000716398.1.71327 WP_000716398.1.71339 WP_000716398.1.71397 WP_000716398.1.71409 WP_000716398.1.71522 WP_000716398.1.71533 WP_000716398.1.71537 WP_000716398.1.71540 WP_000716398.1.71603 WP_000716398.1.71690 WP_000716398.1.71695 WP_000716398.1.71767 WP_000716398.1.71837 WP_000716398.1.71856 WP_000716398.1.71874 WP_000716398.1.71938 WP_000716398.1.71944 WP_000716398.1.71975 WP_000716398.1.71987 WP_000716398.1.71993 WP_000716398.1.72013 WP_000716398.1.7205 WP_000716398.1.72090 WP_000716398.1.7210 WP_000716398.1.72153 WP_000716398.1.72157 WP_000716398.1.72184 WP_000716398.1.72240 WP_000716398.1.7225 WP_000716398.1.72261 WP_000716398.1.72270 WP_000716398.1.72337 WP_000716398.1.72397 WP_000716398.1.72485 WP_000716398.1.72493 WP_000716398.1.72511 WP_000716398.1.72522 WP_000716398.1.72535 WP_000716398.1.72537 WP_000716398.1.72606 WP_000716398.1.72616 WP_000716398.1.72643 WP_000716398.1.72663 WP_000716398.1.72747 WP_000716398.1.72751 WP_000716398.1.72758 WP_000716398.1.72764 WP_000716398.1.7277 WP_000716398.1.72858 WP_000716398.1.72860 WP_000716398.1.72869 WP_000716398.1.72910 WP_000716398.1.72947 WP_000716398.1.73032 WP_000716398.1.73072 WP_000716398.1.73085 WP_000716398.1.73129 WP_000716398.1.73197 WP_000716398.1.73217 WP_000716398.1.73230 WP_000716398.1.73249 WP_000716398.1.73251 WP_000716398.1.73295 WP_000716398.1.73340 WP_000716398.1.73385 WP_000716398.1.73524 WP_000716398.1.73565 WP_000716398.1.73604 WP_000716398.1.73700 WP_000716398.1.73717 WP_000716398.1.73743 WP_000716398.1.73797 WP_000716398.1.73807 WP_000716398.1.73827 WP_000716398.1.73859 WP_000716398.1.73897 WP_000716398.1.73908 WP_000716398.1.73942 WP_000716398.1.73992 WP_000716398.1.73995 WP_000716398.1.73996 WP_000716398.1.74051 WP_000716398.1.7411 WP_000716398.1.7413 WP_000716398.1.7424 WP_000716398.1.74309 WP_000716398.1.74365 WP_000716398.1.74423 WP_000716398.1.74444 WP_000716398.1.74501 WP_000716398.1.74513 WP_000716398.1.74528 WP_000716398.1.74532 WP_000716398.1.74625 WP_000716398.1.74652 WP_000716398.1.74689 WP_000716398.1.74691 WP_000716398.1.74713 WP_000716398.1.74735 WP_000716398.1.7475 WP_000716398.1.74752 WP_000716398.1.74811 WP_000716398.1.74854 WP_000716398.1.74885 WP_000716398.1.74889 WP_000716398.1.74962 WP_000716398.1.74998 WP_000716398.1.75021 WP_000716398.1.75029 WP_000716398.1.75136 WP_000716398.1.75139 WP_000716398.1.75181 WP_000716398.1.75243 WP_000716398.1.75270 WP_000716398.1.75360 WP_000716398.1.75465 WP_000716398.1.75491 WP_000716398.1.75537 WP_000716398.1.75588 WP_000716398.1.75594 WP_000716398.1.75612 WP_000716398.1.75644 WP_000716398.1.75672 WP_000716398.1.75679 WP_000716398.1.75696 WP_000716398.1.75699 WP_000716398.1.75758 WP_000716398.1.7597 WP_000716398.1.75995 WP_000716398.1.75999 WP_000716398.1.76087 WP_000716398.1.76129 WP_000716398.1.76184 WP_000716398.1.76312 WP_000716398.1.76325 WP_000716398.1.76387 WP_000716398.1.76390 WP_000716398.1.76446 WP_000716398.1.76462 WP_000716398.1.76542 WP_000716398.1.76547 WP_000716398.1.7661 WP_000716398.1.76656 WP_000716398.1.76701 WP_000716398.1.76707 WP_000716398.1.76712 WP_000716398.1.76815 WP_000716398.1.76918 WP_000716398.1.76965 WP_000716398.1.76966 WP_000716398.1.77022 WP_000716398.1.77109 WP_000716398.1.77162 WP_000716398.1.77173 WP_000716398.1.77175 WP_000716398.1.77214 WP_000716398.1.77255 WP_000716398.1.7728 WP_000716398.1.77284 WP_000716398.1.77437 WP_000716398.1.77452 WP_000716398.1.77462 WP_000716398.1.77470 WP_000716398.1.77471 WP_000716398.1.77477 WP_000716398.1.77503 WP_000716398.1.77595 WP_000716398.1.77626 WP_000716398.1.77636 WP_000716398.1.77767 WP_000716398.1.77768 WP_000716398.1.7781 WP_000716398.1.77826 WP_000716398.1.77833 WP_000716398.1.77876 WP_000716398.1.77949 WP_000716398.1.77999 WP_000716398.1.78000 WP_000716398.1.7808 WP_000716398.1.78089 WP_000716398.1.78099 WP_000716398.1.78196 WP_000716398.1.78321 WP_000716398.1.78413 WP_000716398.1.78445 WP_000716398.1.78462 WP_000716398.1.7847 WP_000716398.1.78581 WP_000716398.1.78583 WP_000716398.1.78586 WP_000716398.1.78610 WP_000716398.1.78612 WP_000716398.1.78645 WP_000716398.1.78683 WP_000716398.1.78687 WP_000716398.1.78718 WP_000716398.1.78750 WP_000716398.1.7883 WP_000716398.1.78843 WP_000716398.1.78854 WP_000716398.1.78891 WP_000716398.1.78953 WP_000716398.1.7896 WP_000716398.1.78966 WP_000716398.1.7898 WP_000716398.1.79004 WP_000716398.1.7901 WP_000716398.1.79065 WP_000716398.1.79067 WP_000716398.1.79075 WP_000716398.1.79086 WP_000716398.1.79246 WP_000716398.1.79312 WP_000716398.1.79343 WP_000716398.1.79356 WP_000716398.1.79369 WP_000716398.1.7937 WP_000716398.1.79519 WP_000716398.1.79525 WP_000716398.1.79526 WP_000716398.1.79540 WP_000716398.1.79558 WP_000716398.1.79591 WP_000716398.1.79606 WP_000716398.1.79685 WP_000716398.1.79713 WP_000716398.1.79764 WP_000716398.1.79824 WP_000716398.1.79840 WP_000716398.1.79866 WP_000716398.1.7987 WP_000716398.1.79877 WP_000716398.1.7993 WP_000716398.1.79936 WP_000716398.1.79984 WP_000716398.1.80050 WP_000716398.1.8007 WP_000716398.1.80071 WP_000716398.1.80106 WP_000716398.1.80112 WP_000716398.1.80179 WP_000716398.1.80183 WP_000716398.1.80255 WP_000716398.1.80402 WP_000716398.1.80428 WP_000716398.1.80440 WP_000716398.1.80517 WP_000716398.1.8057 WP_000716398.1.80612 WP_000716398.1.80709 WP_000716398.1.80737 WP_000716398.1.80753 WP_000716398.1.80756 WP_000716398.1.8076 WP_000716398.1.80805 WP_000716398.1.80884 WP_000716398.1.8090 WP_000716398.1.80946 WP_000716398.1.81026 WP_000716398.1.81034 WP_000716398.1.81036 WP_000716398.1.81104 WP_000716398.1.81127 WP_000716398.1.81165 WP_000716398.1.81182 WP_000716398.1.8121 WP_000716398.1.81219 WP_000716398.1.8129 WP_000716398.1.81313 WP_000716398.1.81316 WP_000716398.1.81438 WP_000716398.1.81475 WP_000716398.1.81577 WP_000716398.1.81580 WP_000716398.1.81596 WP_000716398.1.81715 WP_000716398.1.81806 WP_000716398.1.81832 WP_000716398.1.81939 WP_000716398.1.81972 WP_000716398.1.82 WP_000716398.1.82059 WP_000716398.1.82074 WP_000716398.1.82137 WP_000716398.1.82217 WP_000716398.1.82239 WP_000716398.1.82240 WP_000716398.1.82242 WP_000716398.1.82246 WP_000716398.1.82316 WP_000716398.1.82326 WP_000716398.1.8235 WP_000716398.1.82439 WP_000716398.1.82485 WP_000716398.1.82700 WP_000716398.1.82711 WP_000716398.1.82715 WP_000716398.1.82754 WP_000716398.1.82799 WP_000716398.1.82831 WP_000716398.1.83020 WP_000716398.1.83035 WP_000716398.1.8306 WP_000716398.1.83093 WP_000716398.1.831 WP_000716398.1.83224 WP_000716398.1.83684 WP_000716398.1.83735 WP_000716398.1.83762 WP_000716398.1.83781 WP_000716398.1.83807 WP_000716398.1.83820 WP_000716398.1.83941 WP_000716398.1.84172 WP_000716398.1.84185 WP_000716398.1.84210 WP_000716398.1.84313 WP_000716398.1.84331 WP_000716398.1.84339 WP_000716398.1.84405 WP_000716398.1.84410 WP_000716398.1.84484 WP_000716398.1.84534 WP_000716398.1.84584 WP_000716398.1.84656 WP_000716398.1.84697 WP_000716398.1.8470 WP_000716398.1.84738 WP_000716398.1.84797 WP_000716398.1.84850 WP_000716398.1.84893 WP_000716398.1.84894 WP_000716398.1.84929 WP_000716398.1.84941 WP_000716398.1.84989 WP_000716398.1.85011 WP_000716398.1.85085 WP_000716398.1.85090 WP_000716398.1.85105 WP_000716398.1.85112 WP_000716398.1.85129 WP_000716398.1.85155 WP_000716398.1.85216 WP_000716398.1.85247 WP_000716398.1.85255 WP_000716398.1.85260 WP_000716398.1.85310 WP_000716398.1.85435 WP_000716398.1.85525 WP_000716398.1.85657 WP_000716398.1.8579 WP_000716398.1.8592 WP_000716398.1.85939 WP_000716398.1.85944 WP_000716398.1.85948 WP_000716398.1.86001 WP_000716398.1.86035 WP_000716398.1.8607 WP_000716398.1.86161 WP_000716398.1.86189 WP_000716398.1.8621 WP_000716398.1.86210 WP_000716398.1.86228 WP_000716398.1.86266 WP_000716398.1.86283 WP_000716398.1.86307 WP_000716398.1.86364 WP_000716398.1.86371 WP_000716398.1.86376 WP_000716398.1.86393 WP_000716398.1.86411 WP_000716398.1.86412 WP_000716398.1.86452 WP_000716398.1.86454 WP_000716398.1.86461 WP_000716398.1.86475 WP_000716398.1.86492 WP_000716398.1.8652 WP_000716398.1.86598 WP_000716398.1.86617 WP_000716398.1.86667 WP_000716398.1.86691 WP_000716398.1.86717 WP_000716398.1.86760 WP_000716398.1.86833 WP_000716398.1.86848 WP_000716398.1.8687 WP_000716398.1.86956 WP_000716398.1.86959 WP_000716398.1.86997 WP_000716398.1.87075 WP_000716398.1.87109 WP_000716398.1.8711 WP_000716398.1.87310 WP_000716398.1.87389 WP_000716398.1.87465 WP_000716398.1.87563 WP_000716398.1.87568 WP_000716398.1.87574 WP_000716398.1.87607 WP_000716398.1.87655 WP_000716398.1.87721 WP_000716398.1.87726 WP_000716398.1.87728 WP_000716398.1.87834 WP_000716398.1.87857 WP_000716398.1.87914 WP_000716398.1.87973 WP_000716398.1.87989 WP_000716398.1.88017 WP_000716398.1.88088 WP_000716398.1.88110 WP_000716398.1.88238 WP_000716398.1.88427 WP_000716398.1.88434 WP_000716398.1.88462 WP_000716398.1.88557 WP_000716398.1.88603 WP_000716398.1.88607 WP_000716398.1.88631 WP_000716398.1.88710 WP_000716398.1.88729 WP_000716398.1.88732 WP_000716398.1.8879 WP_000716398.1.88834 WP_000716398.1.88883 WP_000716398.1.88961 WP_000716398.1.88997 WP_000716398.1.8906 WP_000716398.1.89090 WP_000716398.1.89197 WP_000716398.1.89200 WP_000716398.1.89255 WP_000716398.1.8928 WP_000716398.1.89305 WP_000716398.1.894 WP_000716398.1.89416 WP_000716398.1.89471 WP_000716398.1.89492 WP_000716398.1.89674 WP_000716398.1.89700 WP_000716398.1.89710 WP_000716398.1.89788 WP_000716398.1.89839 WP_000716398.1.89859 WP_000716398.1.89899 WP_000716398.1.89915 WP_000716398.1.89923 WP_000716398.1.90017 WP_000716398.1.90063 WP_000716398.1.90078 WP_000716398.1.9009 WP_000716398.1.90128 WP_000716398.1.90168 WP_000716398.1.90205 WP_000716398.1.90256 WP_000716398.1.90266 WP_000716398.1.90270 WP_000716398.1.90332 WP_000716398.1.90358 WP_000716398.1.9036 WP_000716398.1.90441 WP_000716398.1.90511 WP_000716398.1.90520 WP_000716398.1.90536 WP_000716398.1.90591 WP_000716398.1.90626 WP_000716398.1.90690 WP_000716398.1.90706 WP_000716398.1.90799 WP_000716398.1.9081 WP_000716398.1.90813 WP_000716398.1.90822 WP_000716398.1.90856 WP_000716398.1.90864 WP_000716398.1.90865 WP_000716398.1.90873 WP_000716398.1.90890 WP_000716398.1.90951 WP_000716398.1.90979 WP_000716398.1.91113 WP_000716398.1.91170 WP_000716398.1.91266 WP_000716398.1.91268 WP_000716398.1.91277 WP_000716398.1.91290 WP_000716398.1.91341 WP_000716398.1.91414 WP_000716398.1.91462 WP_000716398.1.91485 WP_000716398.1.91551 WP_000716398.1.91565 WP_000716398.1.9157 WP_000716398.1.91643 WP_000716398.1.91672 WP_000716398.1.9169 WP_000716398.1.9171 WP_000716398.1.91739 WP_000716398.1.91777 WP_000716398.1.91782 WP_000716398.1.91787 WP_000716398.1.91863 WP_000716398.1.91959 WP_000716398.1.92005 WP_000716398.1.92014 WP_000716398.1.92019 WP_000716398.1.92031 WP_000716398.1.92048 WP_000716398.1.921 WP_000716398.1.92102 WP_000716398.1.92161 WP_000716398.1.92215 WP_000716398.1.92311 WP_000716398.1.92323 WP_000716398.1.92361 WP_000716398.1.92434 WP_000716398.1.92496 WP_000716398.1.9255 WP_000716398.1.92568 WP_000716398.1.92614 WP_000716398.1.92615 WP_000716398.1.9266 WP_000716398.1.92668 WP_000716398.1.92693 WP_000716398.1.92742 WP_000716398.1.92780 WP_000716398.1.92781 WP_000716398.1.92792 WP_000716398.1.92845 WP_000716398.1.92943 WP_000716398.1.92953 WP_000716398.1.93016 WP_000716398.1.93019 WP_000716398.1.93048 WP_000716398.1.93054 WP_000716398.1.93112 WP_000716398.1.93133 WP_000716398.1.93150 WP_000716398.1.93175 WP_000716398.1.93252 WP_000716398.1.9327 WP_000716398.1.93276 WP_000716398.1.93312 WP_000716398.1.93388 WP_000716398.1.93509 WP_000716398.1.93569 WP_000716398.1.93626 WP_000716398.1.93637 WP_000716398.1.93652 WP_000716398.1.93673 WP_000716398.1.93745 WP_000716398.1.93755 WP_000716398.1.93873 WP_000716398.1.93911 WP_000716398.1.93951 WP_000716398.1.94008 WP_000716398.1.94011 WP_000716398.1.94025 WP_000716398.1.94057 WP_000716398.1.94156 WP_000716398.1.94176 WP_000716398.1.94187 WP_000716398.1.94232 WP_000716398.1.94271 WP_000716398.1.94298 WP_000716398.1.94317 WP_000716398.1.94353 WP_000716398.1.94388 WP_000716398.1.94404 WP_000716398.1.94548 WP_000716398.1.9457 WP_000716398.1.94578 WP_000716398.1.94626 WP_000716398.1.94646 WP_000716398.1.94738 WP_000716398.1.94787 WP_000716398.1.948 WP_000716398.1.94808 WP_000716398.1.94836 WP_000716398.1.94880 WP_000716398.1.94889 WP_000716398.1.9489 WP_000716398.1.94898 WP_000716398.1.94903 WP_000716398.1.94935 WP_000716398.1.94949 WP_000716398.1.95005 WP_000716398.1.95037 WP_000716398.1.95062 WP_000716398.1.9513 WP_000716398.1.95161 WP_000716398.1.95198 WP_000716398.1.95243 WP_000716398.1.95244 WP_000716398.1.95275 WP_000716398.1.95332 WP_000716398.1.95368 WP_000716398.1.95390 WP_000716398.1.95395 WP_000716398.1.95400 WP_000716398.1.95424 WP_000716398.1.95438 WP_000716398.1.95490 WP_000716398.1.95563 WP_000716398.1.9559 WP_000716398.1.95595 WP_000716398.1.95604 WP_000716398.1.95611 WP_000716398.1.95655 WP_000716398.1.95771 WP_000716398.1.95827 WP_000716398.1.95865 WP_000716398.1.95916 WP_000716398.1.95931 WP_000716398.1.960 WP_000716398.1.96066 WP_000716398.1.96086 WP_000716398.1.96215 WP_000716398.1.96229 WP_000716398.1.96281 WP_000716398.1.96299 WP_000716398.1.96303 WP_000716398.1.96339 WP_000716398.1.96341 WP_000716398.1.96394 WP_000716398.1.96417 WP_000716398.1.96457 WP_000716398.1.96479 WP_000716398.1.96494 WP_000716398.1.965 WP_000716398.1.96541 WP_000716398.1.9657 WP_000716398.1.96585 WP_000716398.1.9661 WP_000716398.1.96659 WP_000716398.1.9668 WP_000716398.1.96817 WP_000716398.1.9690 WP_000716398.1.96924 WP_000716398.1.96936 WP_000716398.1.96944 WP_000716398.1.96984 WP_000716398.1.97011 WP_000716398.1.97027 WP_000716398.1.97123 WP_000716398.1.97231 WP_000716398.1.97238 WP_000716398.1.97351 WP_000716398.1.97360 WP_000716398.1.97361 WP_000716398.1.97418 WP_000716398.1.97421 WP_000716398.1.97459 WP_000716398.1.97502 WP_000716398.1.97538 WP_000716398.1.97544 WP_000716398.1.97685 WP_000716398.1.97705 WP_000716398.1.97930 WP_000716398.1.97932 WP_000716398.1.97937 WP_000716398.1.98012 WP_000716398.1.98026 WP_000716398.1.98115 WP_000716398.1.98202 WP_000716398.1.98232 WP_000716398.1.98235 WP_000716398.1.98241 WP_000716398.1.98292 WP_000716398.1.98294 WP_000716398.1.98301 WP_000716398.1.98355 WP_000716398.1.98404 WP_000716398.1.98424 WP_000716398.1.9844 WP_000716398.1.98442 WP_000716398.1.98451 WP_000716398.1.98477 WP_000716398.1.9858 WP_000716398.1.98628 WP_000716398.1.98665 WP_000716398.1.98683 WP_000716398.1.98776 WP_000716398.1.99046 WP_000716398.1.99209 WP_000716398.1.99292 WP_000716398.1.99295 WP_000716398.1.99304 WP_000716398.1.99319 WP_000716398.1.99345 WP_000716398.1.99361 WP_000716398.1.9940 WP_000716398.1.99446 WP_000716398.1.99453 WP_000716398.1.99471 WP_000716398.1.99475 WP_000716398.1.99511 WP_000716398.1.99562 WP_000716398.1.99592 WP_000716398.1.99602 WP_000716398.1.99619 WP_000716398.1.99632 WP_000716398.1.99827 WP_000716398.1.99869 YP_006780672.1.12065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]