SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82544732|ref|YP_408679.1| from Shigella boydii Sb227

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82544732|ref|YP_408679.1|
Domain Number 1 Region: 34-158
Classification Level Classification E-value
Superfamily PapD-like 1.02e-26
Family Pilus chaperone 0.00096
Further Details:      
 
Domain Number 2 Region: 152-236
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 2.22e-21
Family Periplasmic chaperone C-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|82544732|ref|YP_408679.1|
Sequence length 245
Comment pili assembly chaperone [Shigella boydii Sb227]
Sequence
MPARHLYFIMTNTWNRLALLIFAVLSLLVAGELRAGVVVGGTRFIFPADRESISILLTNT
SQESWLINSKINRPTRWAGGKASTVPAPLLAAPPLILLKPGTTGTLRLLRTESDILPVDR
ETLFELSIASVPSGKVENQSVKVAMRSVFKLFWRPEGLPGDPLEAYQQLRWTRNSQGVQL
TNPTPYYINLIQVSVNGKALSNAGVVPPKSQRQTSWCQAIAPCHVAWRAINDYDGLSAKK
EQNLP
Download sequence
Identical sequences Q31YK7
gi|82544732|ref|YP_408679.1| 300268.SBO_2287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]