SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82545337|ref|YP_409284.1| from Shigella boydii Sb227

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82545337|ref|YP_409284.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.79e-110
Family FMN-linked oxidoreductases 0.0000000000101
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 6.12e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000032
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.51e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000652
Further Details:      
 
Weak hits

Sequence:  gi|82545337|ref|YP_409284.1|
Domain Number - Region: 610-664
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0486
Family C-terminal domain of adrenodoxin reductase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82545337|ref|YP_409284.1|
Sequence length 672
Comment NADPH dehydrogenase [Shigella boydii Sb227]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLHTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSESGGQFNIAKQIP
GKEEFYETLRYYHRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIARFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELNARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A2K0Q137 E7TF31 K0WWJ0 Q31WV2
gi|82545337|ref|YP_409284.1| 300268.SBO_2942 WP_000121441.1.100447 WP_000121441.1.13144 WP_000121441.1.14253 WP_000121441.1.15768 WP_000121441.1.16862 WP_000121441.1.17734 WP_000121441.1.18225 WP_000121441.1.19651 WP_000121441.1.20907 WP_000121441.1.26125 WP_000121441.1.27426 WP_000121441.1.28046 WP_000121441.1.44452 WP_000121441.1.45538 WP_000121441.1.52704 WP_000121441.1.55185 WP_000121441.1.55870 WP_000121441.1.57349 WP_000121441.1.65056 WP_000121441.1.68067 WP_000121441.1.68271 WP_000121441.1.86717 WP_000121441.1.88557 WP_000121441.1.93150 WP_000121441.1.97502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]