SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82546663|ref|YP_410610.1| from Shigella boydii Sb227

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82546663|ref|YP_410610.1|
Domain Number 1 Region: 37-156
Classification Level Classification E-value
Superfamily PapD-like 4.97e-40
Family Pilus chaperone 0.000000562
Further Details:      
 
Domain Number 2 Region: 151-236
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 1.96e-20
Family Periplasmic chaperone C-domain 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|82546663|ref|YP_410610.1|
Sequence length 241
Comment periplasmic chaperone [Shigella boydii Sb227]
Sequence
MSNKNANVRKSQEITFCLLAGILMFMAMMVAGRAEAGVALGATRVIYPAGQKQVQLAVTN
NDENSTYLIQSWMENADGVKDGRFIVTPPLFAMKGKKENTLRILDATNNQLPQDRESLFW
MNVKAIPSMDKSKLTENTLQFAIISRIKLYYRPAKLALPPDQAAEKLRFRRSANSLTLIN
PTPYYLTVTELNAGTRVLENALVPPMGESTVKLPSDAGSNITYRTINDYGALTPKMTGVM
E
Download sequence
Identical sequences A0A2K0Q4N8 E7TAQ8 Q31T26
300268.SBO_4366 WP_000066501.1.100447 WP_000066501.1.11296 WP_000066501.1.13144 WP_000066501.1.13798 WP_000066501.1.14253 WP_000066501.1.15768 WP_000066501.1.16862 WP_000066501.1.17734 WP_000066501.1.18225 WP_000066501.1.19651 WP_000066501.1.20907 WP_000066501.1.21024 WP_000066501.1.2325 WP_000066501.1.26125 WP_000066501.1.27426 WP_000066501.1.28046 WP_000066501.1.35039 WP_000066501.1.44452 WP_000066501.1.44840 WP_000066501.1.45538 WP_000066501.1.52704 WP_000066501.1.55185 WP_000066501.1.55870 WP_000066501.1.57349 WP_000066501.1.65056 WP_000066501.1.68067 WP_000066501.1.68271 WP_000066501.1.86717 WP_000066501.1.88557 WP_000066501.1.93150 WP_000066501.1.97502 gi|82546663|ref|YP_410610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]