SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82546325|ref|YP_410272.1| from Shigella boydii Sb227

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82546325|ref|YP_410272.1|
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 5.49e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.75e-25
Family Ribosomal protein L11, C-terminal domain 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|82546325|ref|YP_410272.1|
Sequence length 142
Comment 50S ribosomal protein L11 [Shigella boydii Sb227]
Sequence
MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVIT
VYADRSFTFVTKTPPAAVLLKKAAGIKSGAGKPNKDKVGKISRAQLQEIAQTKAADMTGA
DIEAMTRSIEGTARSMGLVVED
Download sequence
Identical sequences A0A2K0Q3S8 E7TBC1 I6DFQ1 K0XES6 Q31U14
WP_005009509.1.100116 WP_005009509.1.100447 WP_005009509.1.11296 WP_005009509.1.13144 WP_005009509.1.13798 WP_005009509.1.14253 WP_005009509.1.15768 WP_005009509.1.16862 WP_005009509.1.17734 WP_005009509.1.18225 WP_005009509.1.19651 WP_005009509.1.20907 WP_005009509.1.21024 WP_005009509.1.2325 WP_005009509.1.26125 WP_005009509.1.27426 WP_005009509.1.28046 WP_005009509.1.29230 WP_005009509.1.35039 WP_005009509.1.44452 WP_005009509.1.44840 WP_005009509.1.45538 WP_005009509.1.52704 WP_005009509.1.55185 WP_005009509.1.55870 WP_005009509.1.57349 WP_005009509.1.65056 WP_005009509.1.68067 WP_005009509.1.68271 WP_005009509.1.86717 WP_005009509.1.88557 WP_005009509.1.93150 WP_005009509.1.97502 gi|82546325|ref|YP_410272.1| 300268.SBO_4003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]