SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15897145|ref|NP_341750.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15897145|ref|NP_341750.1|
Domain Number - Region: 13-80
Classification Level Classification E-value
Superfamily PIN domain-like 0.000569
Family PIN domain 0.027
Further Details:      
 
Domain Number - Region: 100-128
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0017
Family Single strand DNA-binding domain, SSB 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15897145|ref|NP_341750.1|
Sequence length 176
Comment hypothetical protein SSO0194 [Sulfolobus solfataricus P2]
Sequence
MRTMLTQKFVVDSMLGKIARWLRIMGYDTLYSNDFEDWKILKIAETQKRIIITRDRGIYY
RSLKRGLNCILLSPDSNIIQDLAFIALRSKIDLSVNINATRCPQCNSVLSKLSESMWLCP
KCKKEYWKGRHWRTIEEIIIKANSELVKLETKNDSRGTGTDTGVKRRDRTVTNRNS
Download sequence
Identical sequences A0A0E3K5P9 D0KRP4 Q980T3
WP_009990432.1.14611 WP_009990432.1.22626 WP_009990432.1.43719 WP_009990432.1.57434 WP_009990432.1.66040 WP_009990432.1.8449 WP_009990432.1.93834 273057.SSO0194 gi|384433656|ref|YP_005643014.1| 358058 NYSGXRC-10068e gi|15897145|ref|NP_341750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]