SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897185|ref|NP_341790.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897185|ref|NP_341790.1|
Domain Number 1 Region: 23-462
Classification Level Classification E-value
Superfamily L-aspartase-like 1.34e-117
Family L-aspartase/fumarase 0.0000000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15897185|ref|NP_341790.1|
Sequence length 474
Comment adenylosuccinate lyase [Sulfolobus solfataricus P2]
Sequence
MRLQYKLINVEHTLQLAMEDSICPLEWRYGSNEMRKFFSREEILKRRIQVEIALLKALTK
YGLVKEEDVQKVEKASLTIRPEEVDELESKIGHDVMAMVVLMAERSGDSGRYVHFGATSY
DIVDTAYALVFRDAIRLVKTKVVEILEMMVSLAIKYKDLAMVGRTHGQHALPITLGFKIA
NYIYEFSRSLERLNEVEKRIVKGKMAGAVGTMAAWGNIGLEIEENVMKFLGLRPHEISTQ
VAPRDAFAELTSDLAILASQCDRFALEVRELMRPEINEISEGVEGRVGSSTMPQKENPVT
SEKIGGLAKVLRSLVVASLENIPLWHERDLTNSSSERIIISHEFLVIDEILDSMISLLRN
LRVNFENIEKNLNLTKGQIMAESLMINLTLKGMKRHEAHQYVNKLTSKVRQTGKTLLEVC
LEDSLILSYFSKQELENVLNPKNYLGSYDKLIERAISYAKGVIKGSEIREAQDR
Download sequence
Identical sequences A0A0E3GUW0 Q980P8
273057.SSO0240 WP_009990495.1.14611 WP_009990495.1.22626 WP_009990495.1.43719 WP_009990495.1.57434 WP_009990495.1.66040 WP_009990495.1.8449 WP_009990495.1.93834 gi|15897185|ref|NP_341790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]