SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897250|ref|NP_341855.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897250|ref|NP_341855.1|
Domain Number 1 Region: 24-157
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000000987
Family GHMP Kinase, N-terminal domain 0.0062
Further Details:      
 
Domain Number 2 Region: 216-260
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000259
Family Homoserine kinase 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15897250|ref|NP_341855.1|
Sequence length 275
Comment hypothetical protein SSO0308 [Sulfolobus solfataricus P2]
Sequence
MGEVCEIMQAYGGVSIVNALPSWYGSSMAINLKVKVEIREGKRVYSQESELIKTILNYFK
EKYSIPDIEVDIESELPQKSGLKSSSAVSVALIAEIAKQYDLRNINPPILSAILSLKAGV
SYTGALDDAVASYCGGIAFTYNKMFRIVKLENLEDNLSILILAKGGRQKPVNLNELRKYS
HVFEEIFKIALKDYLTAMKMNGILIANILGYSLEPIEIALKKGALAAGISGNGPSYFAVS
KNGEEGPIYESLKKFGDVIIVRPVSLDCKDLSIKD
Download sequence
Identical sequences A0A157SXI1 Q980I6
273057.SSO0308 gi|15897250|ref|NP_341855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]