SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897263|ref|NP_341868.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897263|ref|NP_341868.1|
Domain Number 1 Region: 13-156
Classification Level Classification E-value
Superfamily Nqo5-like 4.45e-41
Family Nqo5-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15897263|ref|NP_341868.1|
Sequence length 169
Comment NADH dehydrogenase subunit C [Sulfolobus solfataricus P2]
Sequence
MGDEKMSEALKSLVNDLQTKFKCQAKIESDRRITVIVPDKKIIRDVASFLKDFGFDHVKA
VTGIDYPEHEKLEVVYHISSYSNLDLAKIILALRTTVSYKDPSLPSLYSIFESAWTGERE
TYEMLGIRFEGHPDLRRFFLDEDFEGVYPLRKSYKIKLEGVFVDKPTTE
Download sequence
Identical sequences A0A157SY24 Q980H4
gi|15897263|ref|NP_341868.1| 355629 356342 SsT95 273057.SSO0323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]