SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897288|ref|NP_341893.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897288|ref|NP_341893.1|
Domain Number 1 Region: 6-53
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 2.35e-18
Family Ribosomal protein L39e 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15897288|ref|NP_341893.1|
Sequence length 53
Comment 50S ribosomal protein L39e [Sulfolobus solfataricus P2]
Sequence
MEMSRNKPVAKKFRLAKALKANSPIPIWIVLKTRGRVRYNPLRRNWRRNDLKV
Download sequence
Identical sequences A0A157SY62 D2PD95 M9UAE1
273057.SSO5672 gi|15897288|ref|NP_341893.1| gi|284998267|ref|YP_003420035.1| gi|479326037|ref|YP_007866092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]