SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897291|ref|NP_341896.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897291|ref|NP_341896.1|
Domain Number 1 Region: 113-385
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.97e-77
Family NadC C-terminal domain-like 0.000000186
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 9.42e-33
Family NadC N-terminal domain-like 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15897291|ref|NP_341896.1|
Sequence length 387
Comment nicotinate phosphoribosyltransferase [Sulfolobus solfataricus P2]
Sequence
MEFYIADFKQIKEGKVTDIYFERTLKTLEYLGIKDAKVRMEVHSYGLPKGYEWALFTGLE
EVLHLLEGVPVNVYAMPEGTLFKEIEPVMIIEGNYLDFGIYETAFLGILRHYSSISTKAA
RLKFLAMDKTLFFFGLRSLHPALAPMADRAAYIGGMDGVSGAMSKEYLGVDPSGTMPHAL
MLIVGDNVKAWKAFDEAMGSEVPRITLVDTFEDERTEALKAATLLGKKLYGIRLDTPSSR
RGNFRKIIQEVKWTLKIHGYDHVKIFASGGIDEDDIINLRDIVDGFGIGTSIAFPPSVDF
SADIVEKFVDGKWVPFTKRGKWPGAKQVYRCGKLNDVITLMDQEHPSSDCKPLLQKYMEN
GKIIKPLPSPKEIREYVIKQLTELQSS
Download sequence
Identical sequences A0A0E3ME87 D0KS45 Q980F6
273057.SSO0354 WP_009990652.1.14611 WP_009990652.1.22626 WP_009990652.1.43719 WP_009990652.1.57434 WP_009990652.1.66040 WP_009990652.1.8449 WP_009990652.1.93834 gi|384433807|ref|YP_005643165.1| NYSGXRC-6261p gi|15897291|ref|NP_341896.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]