SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897298|ref|NP_341903.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897298|ref|NP_341903.1|
Domain Number 1 Region: 108-345
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 5.76e-74
Family Creatinase/aminopeptidase 0.00000172
Further Details:      
 
Domain Number 2 Region: 7-130
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.0000000000296
Family Creatinase/prolidase N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15897298|ref|NP_341903.1|
Sequence length 352
Comment prolidase PepQ [Sulfolobus solfataricus P2]
Sequence
MNRLRKLKAILEDKKDSCAIIFGSPNLFYFLEYSGAGALIYCDSRFTLLVPALEMYRAEN
VKDVDIAIYYPSKILENVIEGNIFRAIEKIVNKSNIMLDVSWVEASTYKALSEKYKVIDF
SNEIVRLREVKDNDEIERIRKAGEITAVAMKIGMEKLSEGTSNEKQVAGIIDMTMRSMGA
EDYAFPSIVAFGENSAYPHHIPTDRVLGNNDIVLFDIGAKYNGYCFDSTRTFVFKNSEAK
KVYEVVLEAQMEAIDAVRDGVMASEVDITARRVIEKAGYGKYFIHSTGHGVGVEIHESPA
VSMNSKQILKENMIITVEPGIYLKGRFGIRIEDTLIVTKGKPIVLETAYKLL
Download sequence
Identical sequences A0A0E3K0K0 D0KS55 Q980E9
gi|15897298|ref|NP_341903.1| WP_009990663.1.14611 WP_009990663.1.22626 WP_009990663.1.43719 WP_009990663.1.57434 WP_009990663.1.66040 WP_009990663.1.8449 WP_009990663.1.93834 gi|384433817|ref|YP_005643175.1| 273057.SSO0363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]