SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897315|ref|NP_341920.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897315|ref|NP_341920.1|
Domain Number 1 Region: 256-590
Classification Level Classification E-value
Superfamily SIS domain 5.83e-87
Family double-SIS domain 0.00000742
Further Details:      
 
Domain Number 2 Region: 2-234
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.37e-65
Family Class II glutamine amidotransferases 0.00000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15897315|ref|NP_341920.1|
Sequence length 591
Comment glucosamine--fructose-6-phosphate aminotransferase [Sulfolobus solfataricus P2]
Sequence
MCGIIGIVSNKESNRLAELVVSCLNRLEYRGYDSVGVAALSGGNLEVRKAKGTVEEVVRK
KNIKELSGYAFLGHTRWATHGAPTDYNAHPHTDCINNIAVIHNGTIRNFKELRDELQALG
HKFKSETDTEVIPHMMEEYMKRGMDTFQAFRSAIKNIQGSYAVLAIVKGERRIFFAKRDN
PLVIGLGDDKTFVASDIPSFLPYTRKVIVISDGELGYVTPNTVYMEDENGNPIDVTSRIK
IIDWDASSASKQGYPHFMLKEIHESPIAVKDTISGLLSEVDKINEIAEEIRESSRIIVTA
AGTSYHAGLYFSLLLTRKGYTVIPLIASEYHNFRARKGDIVLAISQSGETLDVKMGIRKF
KDEGAKIIALTNVIESDIARESHYKLYMRAGPEIGVAATKTFTSEIVSLLFLYSLIEKES
ISYLETAHETVRNVITETEGFAKKIGEELANKNNVYYLGRGLGVPLAMEGALKIKEIAYI
HAEAYPAGESKHGPIALVESGFPIIFVNDGELVDELEKNLQEMKARGGKTYSISVNKRLN
FADTEILVNTSEKLSSLAIAPIIQLIAYYASVKRGYDPDKPRNLAKTVTVE
Download sequence
Identical sequences A0A0E3GTE6 D0KS72 Q980D3
WP_009988819.1.14611 WP_009988819.1.22626 WP_009988819.1.43719 WP_009988819.1.57434 WP_009988819.1.66040 WP_009988819.1.8449 WP_009988819.1.93834 gi|15897315|ref|NP_341920.1| 273057.SSO0382 gi|384433834|ref|YP_005643192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]