SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897316|ref|NP_341921.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897316|ref|NP_341921.1|
Domain Number 1 Region: 2-190
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.04e-40
Family GHMP Kinase, N-terminal domain 0.00028
Further Details:      
 
Domain Number 2 Region: 178-309
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.18e-22
Family Mevalonate kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15897316|ref|NP_341921.1|
Sequence length 314
Comment mevalonate kinase [Sulfolobus solfataricus P2]
Sequence
MMVEAKVPLKLTLFGEHAVVYDRPAIAMTISESLKVKVSENDKFLIISPSLNIKGVKLDL
NEMKIESDEAKKVLRYVFEVLNYFEMKKPVKIEINSTVEPSVGLGTSAAVIVGTVAAYSK
YLGIDLSRDEIAKISHNIELKVQGIASRMDTYTETYGGLIYFPAGGKGFEKIDTNFELTA
GYIRRSMSTADVLWRVRTLKESNKEVFENILDVIGEITNRAKSLIVEQNFEELGLLMYVN
HGLLFSLGITSPEADEIVSRAKQLGIKGCKISGGGAGGSIICIKSVEAEVLLRSYNARIV
NSTLTKDGVIFSIL
Download sequence
Identical sequences A0A0E3GWH4 D0KS73 Q980D2
273057.SSO0383 gi|384433835|ref|YP_005643193.1| gi|15897316|ref|NP_341921.1| WP_010922957.1.14611 WP_010922957.1.22626 WP_010922957.1.43719 WP_010922957.1.57434 WP_010922957.1.66040 WP_010922957.1.8449 WP_010922957.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]