SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897384|ref|NP_341989.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897384|ref|NP_341989.1|
Domain Number 1 Region: 49-111
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000139
Family Paired domain 0.069
Further Details:      
 
Weak hits

Sequence:  gi|15897384|ref|NP_341989.1|
Domain Number - Region: 99-136
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000418
Family Tetracyclin repressor-like, N-terminal domain 0.049
Further Details:      
 
Domain Number - Region: 5-38
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000555
Family Cgl2762-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15897384|ref|NP_341989.1|
Sequence length 150
Comment hypothetical protein SSO0454 [Sulfolobus solfataricus P2]
Sequence
MSEEENIEKVKKMYEEGLSIREIANQLGLSYSKVRRMLIKAKVNFRGKVPNDKIQKIIEM
GKQGYSANRISRELNINFNTVLRILKKYNLGKKRRKLDAKEIEKIREEYIKGNSIYRIAK
ELNISTNLVVYHLKKMGLYRPIRESSPTSA
Download sequence
Identical sequences A0A0E3K7W1 D0KSE6 Q97ZW9
gi|15897384|ref|NP_341989.1| 273057.SSO0454 WP_009988704.1.14611 WP_009988704.1.22626 WP_009988704.1.43719 WP_009988704.1.57434 WP_009988704.1.66040 WP_009988704.1.8449 WP_009988704.1.93834 gi|384433908|ref|YP_005643266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]