SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897483|ref|NP_342088.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897483|ref|NP_342088.1|
Domain Number 1 Region: 81-192
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 4.05e-20
Family V-type ATPase subunit E 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15897483|ref|NP_342088.1|
Sequence length 194
Comment ATP synthase subunit E (atpE) [Sulfolobus solfataricus P2]
Sequence
MDFEQLLDKSLNKVREEIKTELSKSLDEAIKLLNEGHNKIVQEYSQRINELIVKTKEEIE
GEKARLEVENKRTLLVEKEYWINKVYERVLGKIGEVVKTKEYKDAIENIISKEIKEIREE
KVTIYCSPNDKLMIEKIVGNNKNVTVKTDEKMLGGIKIYFERSGLTRDFSLKLILDQVFD
SMRGKISDMLFGGK
Download sequence
Identical sequences A0A0E3K5Z3 D0KSX7 Q9UWW5
gi|384434089|ref|YP_005643447.1| gi|15897483|ref|NP_342088.1| 273057.SSO0561 WP_009991072.1.14611 WP_009991072.1.22626 WP_009991072.1.43719 WP_009991072.1.57434 WP_009991072.1.66040 WP_009991072.1.8449 WP_009991072.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]