SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15897641|ref|NP_342246.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897641|ref|NP_342246.1|
Domain Number 1 Region: 4-178
Classification Level Classification E-value
Superfamily PHP domain-like 8.24e-19
Family RNase P subunit p30 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15897641|ref|NP_342246.1|
Sequence length 186
Comment hypothetical protein SSO0740 [Sulfolobus solfataricus P2]
Sequence
MLIVESCILNSKLFPYAKRLGYNTIFSEDGLVGIKRVTIKVENGNQLKKAFKKQFVSKEV
LVFVKPLSIDALKYAVINKRVNAVVLDDDNIRIFKKSMLNLLRSYGKFVEISLKSSSGLL
YNAILFAYKWIPNIIFSSYASSFDEIWSPISKISYLTVLGADEEEAYKFVIINPIKLLNE
LNSINN
Download sequence
Identical sequences D0KTE4 Q7LXL2 Q9UXC8
WP_009991314.1.14611 WP_009991314.1.22626 WP_009991314.1.43719 WP_009991314.1.57434 WP_009991314.1.66040 WP_009991314.1.8449 WP_009991314.1.93834 273057.SSO0740 gi|384434256|ref|YP_005643614.1| gi|15897641|ref|NP_342246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]