SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897691|ref|NP_342296.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897691|ref|NP_342296.1|
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 6.54e-28
Family FAD-linked oxidases, N-terminal domain 0.0077
Further Details:      
 
Domain Number 2 Region: 308-350
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 0.000000213
Family Vanillyl-alcohol oxidase-like 0.076
Further Details:      
 
Weak hits

Sequence:  gi|15897691|ref|NP_342296.1|
Domain Number - Region: 127-282
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 0.00824
Family Inosine monophosphate dehydrogenase (IMPDH) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15897691|ref|NP_342296.1|
Sequence length 352
Comment hypothetical protein SSO0788 [Sulfolobus solfataricus P2]
Sequence
MKLCDEYRIPLVPRGAGTSTIGQVLPIYSSIILDMNDMKEVIEIDDKWVKVTPSVKILRT
LDYLRRRGKELRVYPSSFYIATLGGYIAGGDVGIGSFQYGYHFDNNGINSVRVLGVTGKY
TLNGKDTLAVAQAAGTTGVITEAELAIIDYEDWKDQLIRLNDLEEVVKILKKLGEFRSKI
RRITVEDYEALSLVGKDRLDKVGKWNVIVASTLSFGEEVNLRFLDELAFAAIYVTMSKLT
KFKDYFYEVRLLSLDSFLRVVKQVKEALNSNVLIHGDVMTLRGEIIIYTVFISDKSNFEI
IDSIMLKEGIPFEIHSIEVNDRVDEEYRLELMKKYKRIMDPHNILNPGKLRL
Download sequence
Identical sequences Q7LXI5 Q9UXH4
WP_010923081.1.43719 WP_010923081.1.8449 gi|15897691|ref|NP_342296.1| 273057.SSO0788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]