SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15897698|ref|NP_342303.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15897698|ref|NP_342303.1|
Domain Number - Region: 3-67
Classification Level Classification E-value
Superfamily PIN domain-like 0.00107
Family PIN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15897698|ref|NP_342303.1|
Sequence length 291
Comment hypothetical protein SSO0795 [Sulfolobus solfataricus P2]
Sequence
MNMETFFLDTNILVKWIYRKLLNEKEDIERFISSLSKDQCIILDINLSEFESIINDAYNM
VSHIIYEKILSRSDWKELDIKGKFQIINDIRKNFDRLYDEIRKTHYNELISPGGIRQILA
KEFFKKLEDKVVNLDPEVLRNHIALNGRTEDLIDYLSSVKAIIKQKFTVLDNVKILINDY
VIKEIQLIYEGINRHLRNLKSQGYKKVPSRKDQLIFQYLFLLLREGIYDNIVFITDDNDF
ERMYRAILNYSDDIIKGKVDPRGEFRGHAMEIKNTLGKLVIKNINELISNK
Download sequence
Identical sequences Q7LXH8 Q9UXI1
273057.SSO0795 gi|15897698|ref|NP_342303.1| WP_010923088.1.43719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]