SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897806|ref|NP_342411.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897806|ref|NP_342411.1|
Domain Number 1 Region: 3-264
Classification Level Classification E-value
Superfamily Folate-binding domain 2.51e-61
Family Aminomethyltransferase folate-binding domain 0.00000642
Further Details:      
 
Domain Number 2 Region: 257-346
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 7.68e-19
Family Aminomethyltransferase beta-barrel domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15897806|ref|NP_342411.1|
Sequence length 346
Comment glycine cleavage system aminomethyltransferase T [Sulfolobus solfataricus P2]
Sequence
MFVSPFHDVEEKLGANFGEFAGWEMPMSFTSYAEEHMCVRNSVAFFNLSHMGRLRVKGNP
REFEMLVAKEVNKANSGIMIGPTAFLNDKAGFKDDVMVYKVSENEWLIVTNAINREKIVN
WIKSNSNLDVEDLTFKYGMIAIQGRKLEEILGKNELKQLEFKLNTRFMGYDVFLISRSGW
TGENGLEVWVTLDVGRQLMMDLVKIGIKPAGLIARDSLRQEMGFVLYGEDIDETITPVEA
RYWVFSLEKDFIGKDSLVERIRSGIDKVRIGFKMRKGERTIPRHQSKIYSIGNEVGYVTS
STFSPYLNRVIGMGYVNPKYFYLGYSLTGEIRGKQYDIKIDEFPFI
Download sequence
Identical sequences A0A157SZT0 Q97ZI7
gi|15897806|ref|NP_342411.1| 273057.SSO0919 WP_010923152.1.43719 WP_010923152.1.8449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]