SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897834|ref|NP_342439.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897834|ref|NP_342439.1|
Domain Number 1 Region: 44-174
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 1.77e-41
Family CTP-dependent riboflavin kinase-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15897834|ref|NP_342439.1|
Sequence length 175
Comment hypothetical protein SSO0955 [Sulfolobus solfataricus P2]
Sequence
MEDDKLIVRIISKEGEIIRLTEEGERFLSSCLSSLKDAILSLHSIEIKGNIVSGLGEGKI
FLSMEYYKSQINKIMGFDPFPGTLNIVIYDKASLENRLLLDSSPSLMVPEYKQKDRVLGA
VKLYPAAINKLTPAAVVIPLRTTHPKSVIEIISPFHLREKLNLKDGDEVTIEVYV
Download sequence
Identical sequences A0A0E3MJL8 D0KTS3 Q97ZG3
273057.SSO0955 gi|15897834|ref|NP_342439.1| gi|384434385|ref|YP_005643743.1| WP_009992394.1.14611 WP_009992394.1.22626 WP_009992394.1.43719 WP_009992394.1.57434 WP_009992394.1.66040 WP_009992394.1.8449 WP_009992394.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]