SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897872|ref|NP_342477.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897872|ref|NP_342477.1|
Domain Number 1 Region: 104-272
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.16e-56
Family NadC C-terminal domain-like 0.0000125
Further Details:      
 
Domain Number 2 Region: 2-103
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2e-18
Family NadC N-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15897872|ref|NP_342477.1|
Sequence length 275
Comment nicotinate-nucleotide pyrophosphorylase [Sulfolobus solfataricus P2]
Sequence
MIDWIYVKRLLDYLEEDVMPEDITTKFLEGIRARGIVRCKDSGILAGNRFIVPFLKYLGF
SNINGEKDGREVKKGDIVLNFEGDADILTVERLILNFLGKLSGIATITNLMVKKAKEVNP
YVRIAGTRKTTPGFRLFEKYAIEVGGGDPHRYNLSDAVLIKDNHITLYGNLEELIKRVKF
SVSFTKIIEVEVSSYEDAIRAFKAGADVILLDNMKPYEILPIVNELKSKVLLEASGGITP
DNVIDYAKTGVDVISSGYITHSYRSLDFSLDVEKI
Download sequence
Identical sequences A0A0E3MJK0 D0KTW5 Q97ZC6
WP_009989246.1.14611 WP_009989246.1.22626 WP_009989246.1.43719 WP_009989246.1.57434 WP_009989246.1.66040 WP_009989246.1.8449 WP_009989246.1.93834 273057.SSO0996 gi|15897872|ref|NP_342477.1| gi|384434427|ref|YP_005643785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]