SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15897967|ref|NP_342572.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15897967|ref|NP_342572.1|
Domain Number 1 Region: 7-136
Classification Level Classification E-value
Superfamily Single hybrid motif 3.8e-25
Family Biotinyl/lipoyl-carrier proteins and domains 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15897967|ref|NP_342572.1|
Sequence length 140
Comment glycine cleavage system protein H [Sulfolobus solfataricus P2]
Sequence
MKILGFTFPDDLLYEPEKHVWVRIEDNSVVSIGVTDLGQYMAGKIFQVTAKQKGEKVNGR
SVLFSIESAKWIGKFRLPIEGEVFDVNEEVVKNPSIINERPYDSWIVKIRVEDMDIIKRT
FKPIQEVYKQFEEEAKRVVR
Download sequence
Identical sequences A0A0E3MJN9 D0KU65 Q97Z34
WP_009989738.1.14611 WP_009989738.1.22626 WP_009989738.1.43719 WP_009989738.1.57434 WP_009989738.1.66040 WP_009989738.1.8449 WP_009989738.1.93834 gi|384434527|ref|YP_005643885.1| gi|15897967|ref|NP_342572.1| 273057.SSO1105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]