SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15897980|ref|NP_342585.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15897980|ref|NP_342585.1|
Domain Number - Region: 11-116
Classification Level Classification E-value
Superfamily SIS domain 0.0278
Family double-SIS domain 0.077
Further Details:      
 
Domain Number - Region: 108-146
Classification Level Classification E-value
Superfamily PIN domain-like 0.0765
Family PIN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15897980|ref|NP_342585.1|
Sequence length 150
Comment hypothetical protein SSO1118 [Sulfolobus solfataricus P2]
Sequence
MDNLLKFSGFNISSSGSTVDTLILLYPKLINLACLYIFNMFAVISPSAFGKLKEILGSNK
NYKFVITTLGVSFAIKSGIDIDSALDRGVIVRAFSHKPPKVGNLPQYESEAIMVAFELNA
LLIAEDKDVINKAKELGVNAIPIEELLASS
Download sequence
Identical sequences A0A157SZX8 Q97Z22
gi|15897980|ref|NP_342585.1| 273057.SSO1118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]