SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898009|ref|NP_342614.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898009|ref|NP_342614.1|
Domain Number 1 Region: 10-242
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 2.36e-71
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00019
Further Details:      
 
Domain Number 2 Region: 229-361
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 0.000000000000078
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898009|ref|NP_342614.1|
Sequence length 363
Comment acyl-CoA dehydrogenase [Sulfolobus solfataricus P2]
Sequence
MNEEEYRLKLREWIRNSAPESLKGRKILFETVEFDDYNELRSWQRKLADAGYLGITWPKE
YGGQGLDPIYEVIAYEEFIRAGLPYGRSLGSIGLMVVAPAILKHGNEDQKRRYLPRILRA
EDIWCQGFSEPQAGSDLASVTTRAEDKGDYFLVNGQKIWSSYAHIADYMILLARTGEDKY
KGLTMFILNMKQEGIRVSPINQLTGKSDFNTVYFNNVKVPKNNVIGNVGDGWKVAMTVLN
HERFMLGVTMLFTSKIALESLKGVKEKEELEDEVEGLEAFYRRILIKLRKGEDIDVEGSM
LKLLASELLQRIYEIAVMNYDLETIMKEKWYLGMLASRGRTIAGGTSEILRNVVGERALK
LPK
Download sequence
Identical sequences A0A0E3GTS8 D0KUD1 Q97YZ6
WP_009991592.1.14611 WP_009991592.1.22626 WP_009991592.1.43719 WP_009991592.1.57434 WP_009991592.1.66040 WP_009991592.1.8449 WP_009991592.1.93834 273057.SSO1153 gi|15898009|ref|NP_342614.1| gi|384434571|ref|YP_005643929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]