SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898110|ref|NP_342715.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898110|ref|NP_342715.1|
Domain Number 1 Region: 245-583
Classification Level Classification E-value
Superfamily SIS domain 3.9e-75
Family double-SIS domain 0.0000161
Further Details:      
 
Domain Number 2 Region: 3-227
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.12e-44
Family Class II glutamine amidotransferases 0.0000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898110|ref|NP_342715.1|
Sequence length 584
Comment glutamine--fructose-6-phosphate transaminase [Sulfolobus solfataricus P2]
Sequence
MGGIFAFVCKDSIDVSIINKGLKKLIYRGYDSAGIAYLEDDSLVIKKILGNISKNEISVS
DKARVAIGHTRYASRGWPTLENAHPLTDCNGKIAVVMDGILDDYEKIREDLIAKGHKFVS
TTDAEVIPHLLENSTNYLNSSLNVMKRVKGIYSLVFVTIDIDKIFAINSGQPLMIGITQE
CKYVSSDLPSLSGFAENAIIMPENTVAVISWNDVQVYNIEGNEVKPEIKRVKYKEEIAEK
GGFPHFMLKEIYDIPQALINSFNSLMEKYLSLASMIVYGAKNVYIIGNGTSLHAGFISSY
YFSEISLNVNVVSAAEFPYYALKNVTTGSVIIAISQSGETSDVIRSIKMAKQRGAVILGI
TNSVGSRLALESNVYLPITAGPEMAVPATKTFTSTIVVLKVLSLYTGLHSGKNDRSEISS
LKSEIEELAKQLMVRLPEMEKEAEKLAPKLDKESLYISSSGINYPIALEGALKFKEASMT
HAEGIQLGELLHGPIVLTNKGYPVILIKPVEAEDLYNKVIRSIKERGDVIVTVAEDGDMK
SIKATRDLTPISNVIPLHLLAYKLGVRKGLPIDTPPGLVKAVIV
Download sequence
Identical sequences A0A0E3GTU5 D0KUL5 Q97YQ6
WP_009990024.1.14611 WP_009990024.1.22626 WP_009990024.1.57434 WP_009990024.1.66040 WP_009990024.1.8449 WP_009990024.1.93834 gi|384434655|ref|YP_005644013.1| 273057.SSO1268 gi|15898110|ref|NP_342715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]