SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898202|ref|NP_342807.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898202|ref|NP_342807.1|
Domain Number 1 Region: 6-126
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000151
Family Cgl2762-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15898202|ref|NP_342807.1|
Sequence length 147
Comment transposon ISC1048 Orf1 [Sulfolobus solfataricus P2]
Sequence
MQDLVQAYKEEKNARIKERILAVKLHVVDGKSEKEVSKMLNKGYSTIKLWIGKYKKEGLD
GLKDKPRSGRPRKVEEEKIKQILEDKPQKYGIQQEYWTMKTLKIALQEQGIEYKKSRLYE
LVHELGYNLVKPRPTNIQAEKDKWEDF
Download sequence
Identical sequences Q97YG1
gi|15898202|ref|NP_342807.1| WP_010923354.1.8449 273057.SSO1362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]