SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898249|ref|NP_342854.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898249|ref|NP_342854.1|
Domain Number 1 Region: 53-170
Classification Level Classification E-value
Superfamily PIN domain-like 0.0000000294
Family PIN domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898249|ref|NP_342854.1|
Sequence length 244
Comment hypothetical protein SSO1409 [Sulfolobus solfataricus P2]
Sequence
MHGNADVKFGNESVFDLARGSSTNDELLNICMIRSGFKKFEEEKEIQNTDGFFIADTSVY
IKLGNRLGYLTKDRLLASKSVYNELSERTKLTQMGKEIIVFYLGMYSYRHLHKSPPVSEY
NKSGDIPLIEETRKIKENIPEKVTLITADRQLKQRARTLGVNVIFLNTLKSDSGNMSELL
LCASNRREYMEKYDYARRDLTITINDKEVIKIESDPTKEGFSRIKTLNKEFNYAKLIEKL
YEMI
Download sequence
Identical sequences A0A157T1I4 Q97YB9
WP_010923381.1.43719 WP_010923381.1.8449 273057.SSO1409 377774 gi|15898249|ref|NP_342854.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]