SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898255|ref|NP_342860.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898255|ref|NP_342860.1|
Domain Number 1 Region: 67-177
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000152
Family Transposase inhibitor (Tn5 transposase) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898255|ref|NP_342860.1|
Sequence length 229
Comment second ORF in transposon ISC1439, partial [Sulfolobus solfataricus P2]
Sequence
MGEKEQEKAEGFLLYNWKRKGIKMRSLDLVYPLRLPLLVEIADLRSDSPSQFLLRSVMEV
SQYMEIDYVVADAGFLNLGVIKEMPVKTIVRGKSNLKGFKELSNVPLVEKRYEVKDRVYV
AYRVLKFEGLYYYDVVYVKGKPRHFMFVTNFEGDPYELAELYRLRWQVEEGFKVRKARIR
YVRKLSNKIFLFLYYTVLDSAWNLVNHLLFNFKSTCKKGLSFDSFVKLL
Download sequence
Identical sequences A0A157T0W8 Q97TU7
273057.SSO1408 273057.SSO1417 gi|15898247|ref|NP_342852.1| gi|15898255|ref|NP_342860.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]