SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898288|ref|NP_342893.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898288|ref|NP_342893.1|
Domain Number 1 Region: 31-131
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.17e-17
Family Nucleotide and nucleoside kinases 0.078
Further Details:      
 
Weak hits

Sequence:  gi|15898288|ref|NP_342893.1|
Domain Number - Region: 3-25
Classification Level Classification E-value
Superfamily AF1782-like 0.0209
Family AF1782-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898288|ref|NP_342893.1|
Sequence length 139
Comment hypothetical protein SSO1456 [Sulfolobus solfataricus P2]
Sequence
MRLEIAEKYMAEAYEYLKKGDTIQASGKAYKVAEEIVKAIKFLISKLIGQDVGVISPYRT
QVRKLDQELANYKPYVEVNTVDAFQGREKDVIIFSVTATNGLRFVTNRRRLNVAFTRPRY
KLIVLGNENSIMSCQMTIC
Download sequence
Identical sequences A0A0E3MEB8 Q97Y82
WP_009989267.1.14611 WP_009989267.1.22626 WP_009989267.1.43719 WP_009989267.1.57434 WP_009989267.1.66040 WP_009989267.1.8449 WP_009989267.1.93834 SsR83 SsT114 273057.SSO1456 gi|15898288|ref|NP_342893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]