SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898323|ref|NP_342928.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898323|ref|NP_342928.1|
Domain Number 1 Region: 8-100
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000000000897
Family PIN domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898323|ref|NP_342928.1|
Sequence length 107
Comment hypothetical protein SSO1493 [Sulfolobus solfataricus P2]
Sequence
MKDAETLDFALVEVSNVVWKKAVLTGELTGKDVIKAITIVKEYLPQLLTVNKSIDLIERA
IEISVNEKITVYDSLYIALAECKGSKLVTGDKKQYDVAKKYVISELI
Download sequence
Identical sequences A0A0E3K1D9 D0KV95 Q97Y53
273057.SSO1493 gi|384434752|ref|YP_005644110.1| WP_009991658.1.8449 WP_009991658.1.93834 gi|15898323|ref|NP_342928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]