SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898341|ref|NP_342946.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15898341|ref|NP_342946.1|
Domain Number - Region: 20-58
Classification Level Classification E-value
Superfamily AF1782-like 0.00419
Family AF1782-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898341|ref|NP_342946.1|
Sequence length 156
Comment hypothetical protein SSO1515 [Sulfolobus solfataricus P2]
Sequence
MEELIKKAKEYDIDINDLIIDAISRKDPKEAINLRIELAKKYITETEDYLKKGDAVQASE
KAYKTAEEIVKALAEKFNIPEYQQALKEGRWYTYWLASAVNRLAKDLGDWVLNGWNSAYI
LHVWGFHEAKLSTADISEHLRKVKEMLDNVINIIGK
Download sequence
Identical sequences A0A0E3KCN1 D0KVA8 Q97Y35
gi|15898341|ref|NP_342946.1| 273057.SSO1515 SsR19 gi|384434765|ref|YP_005644123.1| WP_009990105.1.14611 WP_009990105.1.22626 WP_009990105.1.43719 WP_009990105.1.57434 WP_009990105.1.66040 WP_009990105.1.8449 WP_009990105.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]