SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898346|ref|NP_342951.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898346|ref|NP_342951.1|
Domain Number 1 Region: 29-257
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 1.7e-38
Family Purine and uridine phosphorylases 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15898346|ref|NP_342951.1|
Sequence length 274
Comment purine nucleoside phosporylase (deoD) [Sulfolobus solfataricus P2]
Sequence
MPFLENGSMVYGDFIRNQEVRKRITKEELGIEEDEIPERVVVTPMPFNTQFPKNFEDTLT
NLGIKVNRLKVEDQILRQFGGNLLLEKDGNRGFIAFIGRGLIDFTERIRILATVSRIKDI
LFIGTAGSLSNEILIGDLNIPKYAIPFENVSDFYADPTIAIPQADEKLLNEVYEYAEETG
VKTHSTLHATLLFPYSETTEFLNYLLNIGVSTIDMEVSAFYKMSRFYGKRAVAVLRISDM
PLIELHKQEELIKARREIAVNAVFRITLRFLKLI
Download sequence
Identical sequences A0A0E3MKA3 D0KVB0 Q97Y30
gi|15898346|ref|NP_342951.1| 273057.SSO1519 gi|384434767|ref|YP_005644125.1| WP_009988969.1.14611 WP_009988969.1.22626 WP_009988969.1.43719 WP_009988969.1.57434 WP_009988969.1.66040 WP_009988969.1.8449 WP_009988969.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]