SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898358|ref|NP_342963.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898358|ref|NP_342963.1|
Domain Number 1 Region: 10-215
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.32e-52
Family FAD-linked oxidases, N-terminal domain 0.0058
Further Details:      
 
Domain Number 2 Region: 191-449
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 9.81e-29
Family D-lactate dehydrogenase 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15898358|ref|NP_342963.1|
Sequence length 451
Comment alkyldihydroxyacetonephosphate synthase [Sulfolobus solfataricus P2]
Sequence
MQEFINEIQRNFSNCVVEDLDKYKRDWTPLLILEEHLGKNLGKPLLVLSPSTTEEVSNIV
KLANKYYVCIVPYGGGSSVVGGSYHNNCVILDLSKLNRIIEFNEEDLSVTVEVGIKIKDL
EEWLNKRGYTLDYHPQSFYLATIGGAIAHKGSGSHSSSNIENLILWLEVILPNGKAVKVG
SSIRTSMSPDLVRLFIGSEGTLGVITKAKLRIFPLAPYHTDLSFLFPNFHNAIKFTREYV
LRTSPPHRIVVHDKESSEMMLNIPYNIALIRVRGYDEDLVNVNEKIIRQLAMRHNANEGD
RSLIRSWREVFARKYEEQMTKIISQGLWNDTLDLGATWSAMPKLYDKLKESLNSMKGIKN
VLSRVTHVYTNGASLYNVVVMEQDLELLKRVWETAARVIMQLGGTISHHHGVGILKKNWV
KEELGEQYDLLLLIKRMIDSNNIMNPGKVFS
Download sequence
Identical sequences A0A0E3MH52 D0KVB8 Q97Y18
273057.SSO1531 gi|15898358|ref|NP_342963.1| WP_010923456.1.14611 WP_010923456.1.22626 WP_010923456.1.43719 WP_010923456.1.57434 WP_010923456.1.66040 WP_010923456.1.8449 WP_010923456.1.93834 SsT115 gi|384434775|ref|YP_005644133.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]