SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898374|ref|NP_342979.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898374|ref|NP_342979.1|
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000251
Family Recombinase DNA-binding domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898374|ref|NP_342979.1|
Sequence length 79
Comment transposon ISC1395 Orf1 [Sulfolobus solfataricus P2]
Sequence
MSTVYRWINQFEKEGEKCLFYKERKGRNKKIDEKEIKVEELQGKTIWEAKAYIEEKFHVK
LSYVTAWRIARKRLKIPYI
Download sequence
Identical sequences A0A157T1U6 Q97Y02
273057.SSO8351 gi|15898374|ref|NP_342979.1| WP_009992859.1.8449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]