SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898411|ref|NP_343016.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898411|ref|NP_343016.1|
Domain Number 1 Region: 273-436
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 5.8e-36
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 53-269
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 2.09e-27
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898411|ref|NP_343016.1|
Sequence length 546
Comment partial transposase ISC1225, partial [Sulfolobus solfataricus P2]
Sequence
MSKGNSPFSYISSAYGKNHFNIDKPLQKILEYFDVKADFSKLGEFAGGELYEIAEHVDKR
ARPIHVMWSVNGERVDEVWIDPSLRAAIKRLIKDFDINKFPYKEENWHKHYASIYLVSDP
GIACILTITNQTAYALYKYGSEELKKYVPYLIGDSDELLFGATWFTEIQGGSDLGSNLVE
AEFNGKYWLLKGNTKYFASGVGLADLALVSARPMGSKSGAKGLSLFLVPKKNNKGEKNFL
IRRLKRKSGTNSVPTGEVEFNSSEAYLIGEKEYGIYYITEDLMVSRLSNAVGALGIARKS
FLESYYYSQSRKAFGKALIEHPLIQKDLLEMELMIEGGMVVTFKAIDQFQKSWKAMPPFY
NEQYHYARLLTHISKHITAEIASQVSRMAMEIHGGIGFLEEFPIERLHREALITPIWEGT
GNIQALEMLEAMVKKEAHRQLIRDLEGIVNEAKDEIASKTLDFIKDKATTLLTYREYEMQ
FYSKDLLLTLGHGISVILLSHMGRKLGIERFTMLSKIYYERFLMGRSILRDYISEIRELI
NMEEMK
Download sequence
Identical sequences A0A157T1E6 C3NKZ7 C4KEH2 H2C2V8 Q97XW3
gi|229582993|ref|YP_002841392.1| WP_009071332.1.100559 WP_009071332.1.41357 WP_009071332.1.43719 WP_009071332.1.52267 WP_009071332.1.8449 WP_009071332.1.89621 WP_009071332.1.97021 gi|15898411|ref|NP_343016.1| gi|238619012|ref|YP_002913837.1| 2014016639 273057.SSO1598 419942.YN1551_2518 426118.M164_0541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]