SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898514|ref|NP_343119.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898514|ref|NP_343119.1|
Domain Number 1 Region: 70-221
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000235
Family Transposase inhibitor (Tn5 transposase) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15898514|ref|NP_343119.1|
Sequence length 251
Comment partial transposase ISC1359, partial [Sulfolobus solfataricus P2]
Sequence
MVREYPKTTNRIKPTKGTSWGLVQAAIFLLGRTRSFLDVIPVTVKNVAEGFKAVMEVIVK
ELEEDKLRLVMVFADKEFAVNEVIRYLLELGLDFVISAKVQMYKKYKGMLQDVDVSFGGV
RYTGFLCVRYGSGAYLIILRKEDGKIIAFLVRREMDLYDAIVLAEMYRERWGIENAFRSL
EEFRIRTRTCDVRKELVLVLLSYLLLNVWFLIRSWRKVKLWEFSVSLSNLLDREVRVEQG
RAFREVKTPFP
Download sequence
Identical sequences A0A157T3D9 Q97TW7
273057.SSO1703 273057.SSO1796 gi|15898514|ref|NP_343119.1| gi|15898594|ref|NP_343199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]