SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898551|ref|NP_343156.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898551|ref|NP_343156.1|
Domain Number 1 Region: 12-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000197
Family Middle operon regulator, Mor 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898551|ref|NP_343156.1|
Sequence length 152
Comment transposon ISC1078 Orf1 [Sulfolobus solfataricus P2]
Sequence
MPKSRMHGIRLNKKQEEERRINAVKDVRNGMSIKDVAKKYDVSIFTVYKWLRKGDLSAKP
RKGPTKLKDEEKLVRILEKSPRDFGLNYDFWTLKLIAYILDKEFGIKYNPRSLSPVLKKL
GFKYKKGKRTYVRDDNAVERWVKEQGEKLLKK
Download sequence
Identical sequences A0A0E3JYL4 D0KNG8 Q97TX2
WP_010922862.1.8449 WP_010922862.1.93834 gi|15897010|ref|NP_341615.1| gi|15898107|ref|NP_342712.1| gi|15898551|ref|NP_343156.1| gi|15899703|ref|NP_344308.1| gi|384433510|ref|YP_005642868.1| gi|384434750|ref|YP_005644108.1| gi|384434812|ref|YP_005644170.1| gi|384434878|ref|YP_005644236.1| gi|384434922|ref|YP_005644280.1| gi|384435175|ref|YP_005644533.1| 273057.SSO0040 273057.SSO1264 273057.SSO1750 273057.SSO2992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]