SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898585|ref|NP_343190.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898585|ref|NP_343190.1|
Domain Number 1 Region: 8-134
Classification Level Classification E-value
Superfamily PIN domain-like 1.15e-19
Family PIN domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898585|ref|NP_343190.1|
Sequence length 143
Comment hypothetical protein SSO1786 [Sulfolobus solfataricus P2]
Sequence
MERQELAVVDASVVIKWFVNENYSKEALILKEAYVKGLEDLLAPCILPFEVLNGLKYTYS
LGEKELEEVGKILSDFQITLYGFENILDEMVSLSLRYGITIYDAAYIALGKVLNEKVYTA
DERLIRKVKELPFVIHIKDYKQK
Download sequence
Identical sequences A0A0E3K1H9 D0KNG0 Q97XF4
WP_010923587.1.14611 WP_010923587.1.22626 WP_010923587.1.43719 WP_010923587.1.57434 WP_010923587.1.66040 WP_010923587.1.8449 WP_010923587.1.93834 gi|384434870|ref|YP_005644228.1| 273057.SSO1786 gi|15898585|ref|NP_343190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]