SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898637|ref|NP_343242.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898637|ref|NP_343242.1|
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily Transposase IS200-like 0.0000000000000249
Family Transposase IS200-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898637|ref|NP_343242.1|
Sequence length 78
Comment transposase [Sulfolobus solfataricus P2]
Sequence
MPKYLRSTLVDEDVEYTKEILRSIAEELSCKIISLEVMPNHIHLFVNCPSRYVPSYLAKT
TLRLLVTVQINMGTRGMG
Download sequence
Identical sequences A0A157T2P7 Q97XA9
273057.SSO9043 gi|15898637|ref|NP_343242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]