SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898720|ref|NP_343325.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898720|ref|NP_343325.1|
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily PIN domain-like 2.1e-17
Family PIN domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898720|ref|NP_343325.1|
Sequence length 136
Comment hypothetical protein SSO1921 [Sulfolobus solfataricus P2]
Sequence
MSIFVDTNVIISFVEQDVNYNKALKIREINDLMTSEVTVLELYSFFSRKLKDEILAEAST
KYALKVSNVKVVELDMNRLFRKSLELSTKLQLKTLDVLQISSALLLNAKSFITFDKDILK
KRDLIEKIVKISVSEL
Download sequence
Identical sequences A0A0E3K9C5 C3MMA9 C3NKU2 D0KPQ8 D2PIA2 Q97X33
378177 gi|15898720|ref|NP_343325.1| WP_009990338.1.14611 WP_009990338.1.22626 WP_009990338.1.34992 WP_009990338.1.43719 WP_009990338.1.52267 WP_009990338.1.57434 WP_009990338.1.66040 WP_009990338.1.66823 WP_009990338.1.8449 WP_009990338.1.93834 gi|227829598|ref|YP_002831377.1| gi|284997199|ref|YP_003418966.1| gi|229582938|ref|YP_002841337.1| gi|384435055|ref|YP_005644413.1| 273057.SSO1921 419942.YN1551_2456 429572.LS215_0648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]