SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898756|ref|NP_343361.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898756|ref|NP_343361.1|
Domain Number 1 Region: 89-211
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 0.000000000109
Family Band 7/SPFH domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898756|ref|NP_343361.1|
Sequence length 288
Comment hypothetical protein SSO1960 [Sulfolobus solfataricus P2]
Sequence
MSLTIRGQVISTEKEDGSSFMTADAIIFKYPKEAITSKSLIIVQPTERAIVLIQGQIVAD
LPPGSHNIQTPGNPVSAFLSKFRYNTLPYDTVVYFISTTRHEVRVAGVSQTDDLVPLEYE
TAIYFRVQNPAALVTNVQFGSLYFKDADLAHYISPIVDQEVSSVLNRVNLTDVFKKFSEI
STAVTAALKQFLAEIGVDLISVRITRLLPQDPELRRIIQLRDMGIPLMDAVRMGLARILA
EQQNAAAVNMAIGVPYYPNLSTIVNLPDGLIRVGIGRRGQQQSGGAQQ
Download sequence
Identical sequences A0A0E3GU28 C3MX28 C3N4H8 C3NKY4 C4KG22 D0KPU5 M9UCE9 Q97X00
gi|227827227|ref|YP_002829006.1| gi|238619379|ref|YP_002914204.1| WP_009991750.1.100559 WP_009991750.1.14611 WP_009991750.1.22626 WP_009991750.1.27461 WP_009991750.1.43719 WP_009991750.1.44962 WP_009991750.1.47130 WP_009991750.1.48461 WP_009991750.1.52267 WP_009991750.1.57434 WP_009991750.1.60638 WP_009991750.1.66040 WP_009991750.1.68242 WP_009991750.1.74483 WP_009991750.1.83431 WP_009991750.1.84481 WP_009991750.1.8449 WP_009991750.1.89621 WP_009991750.1.90709 WP_009991750.1.91160 WP_009991750.1.93834 WP_009991750.1.97021 gi|384435092|ref|YP_005644450.1| 273057.SSO1960 419942.YN1551_2505 426118.M164_0924 427317.M1425_0915 427318.M1627_0981 gi|15898756|ref|NP_343361.1| gi|229582980|ref|YP_002841379.1| gi|229584447|ref|YP_002842948.1| gi|479324800|ref|YP_007864849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]