SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15898764|ref|NP_343369.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898764|ref|NP_343369.1|
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily PIN domain-like 1.51e-20
Family PIN domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15898764|ref|NP_343369.1|
Sequence length 128
Comment hypothetical protein SSO1968 [Sulfolobus solfataricus P2]
Sequence
MIFLDANFLIYLNSGVSEVKEYYIKLLTYESLFSDPLVIDEVIYVSKKKYGVKYCDTIEF
LDEIVLKYLTVLPITIKEYERAKEIMRKYSVKPSDAFHIAVMLNNSINVILSEDKELDKV
AEIKRIWI
Download sequence
Identical sequences A0A0E3KDP7 D0KPV1 Q97WZ2
gi|15898764|ref|NP_343369.1| WP_009991912.1.14611 WP_009991912.1.22626 WP_009991912.1.43719 WP_009991912.1.57434 WP_009991912.1.66040 WP_009991912.1.8449 WP_009991912.1.93834 273057.SSO1968 378171 gi|384435098|ref|YP_005644456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]