SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898843|ref|NP_343448.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898843|ref|NP_343448.1|
Domain Number 1 Region: 18-290
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 9.77e-77
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00046
Further Details:      
 
Domain Number 2 Region: 281-495
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 7.53e-39
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898843|ref|NP_343448.1|
Sequence length 508
Comment 4-hydroxyphenylacetate-3-hydroxylase [Sulfolobus solfataricus P2]
Sequence
MGCRGGYFHGSIKGVVWMIRRGTDYIKSIKENPPVVYYEGEVVKDVTEHSAFKIPISTVA
KYYDLHWDEKYKEYLRVYNLDVGEETSISFLRPKNKKDLGKLRDGLVKIYDYYRGFFGRS
PDYLNLWTMVFYAHAEDYFGKQFGSKFMENAIEIYKEATKRDLFYTHAIVAPMYDRSRPP
SQWEDPYIQVGIVEEKPEGVVVRGAAMICTAGPYAEMLWYLPNVRRDSDPRYAIYFSIPT
NTKGVKFLSRRGFQPREGGEFEYPISSRFEESDAVLVLDNVLIPWERIIFFKKPELIEDL
MWHTVQLRGWFNWHFVIQHYSRLKFLAGLAIAIAEASGTSNFINVQEKIGEILIYVALNE
AALYASVERAQELPNITRPDPYISISASHFNMKTVPRANEILRSISAGSSIPIPAGIKDF
ENPEERKLLDKYMAMKGLDALERVKMFNLLWDVIGSEAGMRYEQYDRFSRGDPTIRWAQT
YTEVFKDRKHEFVKLVKDIIDQMPNPKA
Download sequence
Identical sequences A0A157T3D1 Q97WR4
354090 273057.SSO2053 gi|15898843|ref|NP_343448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]