SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15898849|ref|NP_343454.1| from Sulfolobus solfataricus P2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15898849|ref|NP_343454.1|
Domain Number 1 Region: 3-224
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 8.12e-57
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000686
Further Details:      
 
Domain Number 2 Region: 212-364
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.77e-44
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15898849|ref|NP_343454.1|
Sequence length 371
Comment acyl-CoA dehydrogenase [Sulfolobus solfataricus P2]
Sequence
MSEKELFIQSLREFLNRDVEKIVNKIDKEDYYPRDLVRKLGELGFLIPLTSGLSNYDMMI
ILEEIAKVSGSLALIADAQGELAGEMIRLYANERQKKEFMEPLSKGEIIGSFALTEPSGG
SDIGSMKTLAEKRNGSWIIKGHKMWITQGLYADVFITVAKTGSSRRDLSVFIVPRSNCVE
TRKIEVMGNRGTGTAEVIFHNCEVSNDYVVGEVNNGWNMVNSVLEIGRLAISGIAIGLAE
AALEEAFKWAKSRFAFGNSIYDFQGIRWYFADAIAKLNAVKSMAKDVSSKFDENSKDKGV
YVSMLKLLSANIANEVIDISLQVFGGMGYAKGTNIERIYRDARLLRIGEGTDEVQRHIIA
KYIEQYGIPYI
Download sequence
Identical sequences A0A0E3GX58 D0KPV9 Q97WQ8
273057.SSO2060 WP_009988843.1.14611 WP_009988843.1.22626 WP_009988843.1.43719 WP_009988843.1.57434 WP_009988843.1.66040 WP_009988843.1.8449 WP_009988843.1.93834 gi|15898849|ref|NP_343454.1| gi|384435106|ref|YP_005644464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]